DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG16710

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_651167.3 Gene:CG16710 / 42790 FlyBaseID:FBgn0039101 Length:372 Species:Drosophila melanogaster


Alignment Length:340 Identity:81/340 - (23%)
Similarity:126/340 - (37%) Gaps:75/340 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDSVVIGISALLFLLP-------VPGSSQYLDGR-CG---------------------LLTNGKI 36
            :|...|.::....|||       .|......:.| ||                     :|.|.:|
  Fly    32 LDEKCISLARCTSLLPFLKPHNMTPAEKAVFEDRYCGYGPKGQELLDRVLICCPNMGHILPNTQI 96

  Fly    37 ANNI---------------SSPWMA---YLHTS------ELLYVCGGTVITEKLVLTAAHCTRAS 77
            ...|               ..||||   |.|.|      .|:..|.|::||.:.|||||||.|.:
  Fly    97 CGPIMPAYRIFGGEETQPNELPWMALILYAHRSRSVWNERLVSRCAGSLITNRYVLTAAHCLRIT 161

  Fly    78 --EQLVARIGE--FIGTDD-----------ANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLA 127
              :....|:||  .:...|           |.:.:..:..:|....|.:.......||||:|.|.
  Fly   162 GLDLRRVRLGEHNILSNPDCVTHINGREHCAPEHLEIDVDLSIKHRHYMVFEERPYNDIALLRLK 226

  Fly   128 TDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNG 192
            ..:.::..|:|||:....|:.....:...|..|.|||.:.:..|:......:..:.|:.||....
  Fly   227 FPVRYTAQIKPICVQLDYIFSNPSFSNHKLQIAGWGLSHKQGYSNVLLQAYVNGRNADECSLSEP 291

  Fly   193 TAILSSQ--FCAGD-SDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTN-QKCKRA-SVYTDVL 252
            :..|..:  .|||: ..:..|..|...||.||:...:.:...|.||.:.. .:|... :.||...
  Fly   292 SLGLDKETHICAGNLGGNDTCKGDSGGPLMAIMERGDEEFVYLAGITSYGYSQCGYGPAAYTKTS 356

  Fly   253 SHTDFILSVWRQYRN 267
            ...::||  |..|.|
  Fly   357 KFVEWIL--WNMYTN 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 66/268 (25%)
Tryp_SPc 33..258 CDD:304450 66/268 (25%)
CG16710NP_651167.3 CLIP 35..84 CDD:288855 8/48 (17%)
Tryp_SPc 105..362 CDD:214473 63/256 (25%)
Tryp_SPc 106..362 CDD:238113 63/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463633
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.