DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG31199

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:318 Identity:67/318 - (21%)
Similarity:113/318 - (35%) Gaps:86/318 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIGISALLFLL-----PVPGSSQYLDGRCGLLTNGKIANNISS-------PWMAYLHTSELLY-- 55
            ::|..|:|.||     |...|::..|.:||.....::.|..|:       .|:|     .::|  
  Fly     1 MLGRIAVLLLLVGLFGPEVRSAKVNDDQCGAFDEDQMLNMQSTFAIPTEHQWVA-----RIVYGK 60

  Fly    56 ---------VCGGTVITEKLVLTAAHC----TRASEQLVARIGEF-----IG-----TDDANDTM 97
                     .|.|.:::::.||..|||    ...:|.....:|..     :|     ||......
  Fly    61 GFEGKIRDNGCLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLGVHNKSAPVGVRVCETDGYCVRP 125

  Fly    98 LSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQW 162
            ..|.::::..||..|::.|..|.:|:|.|..|......:.|||:                  ...
  Fly   126 SQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDAKIYPNVMPICM------------------PPP 172

  Fly   163 GLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCAG------DSDSKLCNVD-------F 214
            .|.|:...:..|.:..:|........|...|  ||..||..      .|.:.:|...       .
  Fly   173 SLLNETLVAQTFVVAGLRVFEDFRLKTWVNT--LSRGFCQSKVKTLVTSSNTVCGYHKQPVAYYL 235

  Fly   215 SSPLGAIITFKNI-QRYVLIGIAT----TNQKCKRASVYTDVLSHTDFILSVWRQYRN 267
            .:||..:....:: |.|.|:||..    .|.:.  .|.:..:.::.|||    ||..|
  Fly   236 GAPLVGLQKKGHVTQNYYLVGIMIDWRWENNRI--MSSFLAIRNYMDFI----RQNSN 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 52/274 (19%)
Tryp_SPc 33..258 CDD:304450 52/274 (19%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 45/236 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.