DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG31219

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001097837.1 Gene:CG31219 / 42344 FlyBaseID:FBgn0051219 Length:345 Species:Drosophila melanogaster


Alignment Length:298 Identity:85/298 - (28%)
Similarity:122/298 - (40%) Gaps:57/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLF----LLPVPGSSQYLDGRCG------LLTNGKIANNISSPWMA---YLHTS--ELLYVCGGT 60
            |||    ..|.||:.......||      .:..|..|.....||||   ||:|:  |:|..|.|:
  Fly    59 LLFGQRICCPPPGNRLPSTEICGQSLSTYRMVGGSEARPNGYPWMAMLLYLNTTTLEILPFCAGS 123

  Fly    61 VITEKLVLTAAHCTRASEQLVA----RIGEFIGT----------DDANDTMLS--EYQVSQTFIH 109
            :|..:.|||:|||.....:.::    |:||...|          |..|...|.  |.::.:..:|
  Fly   124 LINNRYVLTSAHCVNGIPRDLSLKSVRLGEHDITYDPAYNPDCRDQDNQCALPNLEIKLEKIIVH 188

  Fly   110 SLYNTTTSAN---DIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNES 171
            .|:::.::.|   |||:|.|...:.:...|.||||.....:.|     ..|..|.||..|:...|
  Fly   189 GLFSSISNRNIEYDIALLRLKMPVRYRTGIMPICIPKHGFFAK-----SKLEIAGWGKTNEGQFS 248

  Fly   172 DAFRITDIRRQPANMCS------TLNGTAILSSQFCAGDSDS-KLCNVDFSSPLGAIITFKNIQR 229
            .......||.:...:|:      .||    .|.|.|||..|. ..|..|...||  ::|..|...
  Fly   249 QVLMHGFIRERSIAVCALRFPYLDLN----QSLQICAGGYDGVDTCQGDSGGPL--MVTMDNSSV 307

  Fly   230 YVLIGIATTNQK-CKR---ASVYTDVLSHTDFILSVWR 263
            | |.||.|...| |.:   ..:||...:...:|.:|.|
  Fly   308 Y-LAGITTYGSKNCGQIGIPGIYTRTSAFLPWIKAVLR 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 74/259 (29%)
Tryp_SPc 33..258 CDD:304450 74/259 (29%)
CG31219NP_001097837.1 Tryp_SPc 88..339 CDD:214473 74/262 (28%)
Tryp_SPc 90..342 CDD:238113 75/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463629
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.