DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG17475

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:215 Identity:53/215 - (24%)
Similarity:84/215 - (39%) Gaps:62/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGT-----DDANDTMLSEYQVSQTFIHSLYNT 114
            ::|||.:|.|:.|||||||.........|:  ..||     .||      .|.|.:.:||..||:
  Fly    74 HICGGCIIDERHVLTAAHCVYGYNPTYLRV--ITGTVEYEKPDA------VYFVEEHWIHCNYNS 130

  Fly   115 TTSANDIAILGLATDIVFSKTIRP-------------ICIVWW---TIW--------RKYIDNIQ 155
            ....||||::.|...|.|::..:|             :.:..|   .:|        :.|:.:: 
  Fly   131 PDYHNDIALIRLNDTIKFNEYTQPAELPTAPVANGTQLLLTGWGSTELWGDTPDILQKAYLTHV- 194

  Fly   156 VLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSKLCN-------VD 213
            |.|..|..:.||.:..           |.::|:...|    ....|.|||...|.:       |:
  Fly   195 VYSTCQEIMNNDPSNG-----------PCHICTLTTG----GQGACHGDSGGPLTHNGVLYGLVN 244

  Fly   214 FSSP--LGAIITFKNIQRYV 231
            :..|  ||...:..|:..|:
  Fly   245 WGYPCALGVPDSHANVYYYL 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 53/215 (25%)
Tryp_SPc 33..258 CDD:304450 53/215 (25%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 53/215 (25%)
Tryp_SPc 50..269 CDD:238113 53/215 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.