DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG3505

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_650380.2 Gene:CG3505 / 41777 FlyBaseID:FBgn0038250 Length:360 Species:Drosophila melanogaster


Alignment Length:308 Identity:72/308 - (23%)
Similarity:128/308 - (41%) Gaps:95/308 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 DGRCGLLTN------------------------GKI----ANNISS-----PWMAYLH----TSE 52
            |.:||:..|                        ||:    :|:..:     ||:|.:.    ..|
  Fly    68 DNQCGVRGNDVQVCCPSTAGLGALTHPLLPSDCGKVRWQRSNDTDTRIREFPWLALIEYTRGNQE 132

  Fly    53 LLYVCGGTVITEKLVLTAAHC----TRASEQLVA-RIGEFIGTDDAN-----DTMLSE----YQ- 102
            .::.|||.:|:::.|||||||    ..::.|:.| |:||:..:.:.:     |:.:::    || 
  Fly   133 KIHACGGVLISDRYVLTAAHCVAQAATSNLQITAVRLGEWDTSTNPDCQYHEDSKVADCAPPYQD 197

  Fly   103 --VSQTFIHSLYNTT--TSANDIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWG 163
              :.:...|.|||.|  |..||||::.||:....:..::|||:....:....:::: |...|.|.
  Fly   198 IAIEELLPHPLYNRTDRTQINDIALVRLASPAKLNDFVQPICLPNKQLRADELEDL-VTEVAGWQ 261

  Fly   164 LPNDRNESDAFRIT--------------DIRRQPANMCSTLNGTAILSSQFCAGDSDSKLCNVDF 214
            ..:.:.....: :|              .:|.|.:.:|...|      ||.|.|::.        
  Fly   262 ASSSQRMRKGY-VTISSIEECQRKYASQQLRIQASKLCGLTN------SQECYGNAG-------- 311

  Fly   215 SSPLGAIITFKNIQRYVLIGIATTNQ-KCKR---ASVYTDVLSHTDFI 258
                |.::.||| ..|:|.|:.:... .|..   ..|||.|.|:.|:|
  Fly   312 ----GPLMLFKN-DGYLLGGLVSFGPVPCPNPDWPDVYTRVASYIDWI 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 68/298 (23%)
Tryp_SPc 33..258 CDD:304450 68/298 (23%)
CG3505NP_650380.2 CLIP 30..82 CDD:288855 4/13 (31%)
Tryp_SPc 111..356 CDD:238113 65/265 (25%)
Tryp_SPc 111..354 CDD:214473 64/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.