DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG31326

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_650344.2 Gene:CG31326 / 41728 FlyBaseID:FBgn0051326 Length:520 Species:Drosophila melanogaster


Alignment Length:292 Identity:77/292 - (26%)
Similarity:120/292 - (41%) Gaps:77/292 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CG--------LLTNGKIANNISSPWMAYL----HTSELLYVCGGTVITEKLVLTAAHCTRA---- 76
            ||        |:..||.......||:..:    .::...::||||:|:...||:||||.||    
  Fly   263 CGRERASTTPLIFQGKSLQRGQLPWLVAIFERRESNGPAFICGGTLISTSTVLSAAHCFRAPGRD 327

  Fly    77 --SEQLVARI----------GEFIGTDDANDTMLSEYQVSQTFIHS--LYNTTTSANDIAILGLA 127
              :.:|...:          |||.|             |||..||.  .:...|.| |:|::.|.
  Fly   328 LPASRLAVSLGRNTLAIHSDGEFRG-------------VSQLIIHENFQFKQFTEA-DLALVRLD 378

  Fly   128 TDIVFSKTIRPICIVWWTIWRKYIDNIQVLSG--AQWGLPND--RNESDAFRITDIR-RQPANMC 187
            ..:.::..|.|||: |.|..|  :|..|.|..  |.|| |::  ...::..::||:. ...||..
  Fly   379 EPVRYTDYIVPICL-WSTSNR--MDLPQGLKSYVAGWG-PDETGTGNTEVSKVTDLNIVSEANCA 439

  Fly   188 STLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGI---ATTNQK---CK--R 244
            ..|....:..|..||..:.:..|..|...||    ..:....:||.|:   ...|:|   |:  :
  Fly   440 LELPHVLVQPSSLCAKKTGAGPCASDGGGPL----MLREQDVWVLRGVISGGVINEKENTCELSK 500

  Fly   245 ASVYTDVLSHTDFILSVWRQYRNGEKSPKTWD 276
            .||:|||..|.:::    ||        |.|:
  Fly   501 PSVFTDVAKHIEWV----RQ--------KMWN 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 70/259 (27%)
Tryp_SPc 33..258 CDD:304450 70/259 (27%)
CG31326NP_650344.2 GD_N 26..126 CDD:292649
Tryp_SPc 277..517 CDD:238113 72/273 (26%)
Tryp_SPc 277..514 CDD:214473 70/258 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436562
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.