DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG9649

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_650343.1 Gene:CG9649 / 41727 FlyBaseID:FBgn0038211 Length:504 Species:Drosophila melanogaster


Alignment Length:296 Identity:80/296 - (27%)
Similarity:127/296 - (42%) Gaps:69/296 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PVPGSSQY------LDGRCG--------LLTNGKIANNISSPWMAYL--HTS-ELLYVCGGTVIT 63
            |...|..|      |.|.||        .:.||........||||.|  |.. :..::||||:|:
  Fly   228 PAQASKFYPQTIGQLSGICGREKVIQTPFIHNGIEVERGQLPWMAALFEHVGRDYNFLCGGTLIS 292

  Fly    64 EKLVLTAAHCTR------ASEQLVARIGEFIGTDDANDTMLS--EYQVSQTFIHSLYNTTTSAN- 119
            .:.|::||||.|      ..|:.:..:|.     ::.|...|  ...|::..||..||.....: 
  Fly   293 ARTVISAAHCFRFGSRNLPGERTIVSLGR-----NSLDLFSSGATLGVARLLIHEQYNPNVYTDA 352

  Fly   120 DIAILGLATDIVFSKTIRPICIVWWTIWRKYIDN--IQVLSG-----AQWGLPNDRNESDAFRI- 176
            |:|:|.|:..:.....|:|||     :|.   :|  :::.||     |.||  .|...:...|: 
  Fly   353 DLALLQLSNHVDIGDYIKPIC-----LWN---ENFLLELPSGHKSYVAGWG--EDEKGNRNTRLA 407

  Fly   177 ----TDIRRQ---PANMCSTLNGTAILSSQFCAGDSD-SKLCNVDFSSPLGAIITFKNIQRYVLI 233
                |||..|   ..|: |..|...|.|...||.::. |..|:.|  |..|.::..::|  ::|.
  Fly   408 KMTDTDIITQWECRGNL-SEENAKFITSHTICASNAQASGPCSGD--SGGGLMLQEQDI--WMLR 467

  Fly   234 GIATTNQKCKRAS------VYTDVLSHTDFIL-SVW 262
            |:.:..|:.....      :||||..|.:::| |:|
  Fly   468 GVVSAGQRMTNRCNLTLPVIYTDVAKHIEWLLSSMW 503

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 70/258 (27%)
Tryp_SPc 33..258 CDD:304450 70/258 (27%)
CG9649NP_650343.1 GD_N 29..124 CDD:292649
Tryp_SPc 257..498 CDD:238113 70/260 (27%)
Tryp_SPc 259..497 CDD:214473 70/257 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436595
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.