DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG13318

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_649831.1 Gene:CG13318 / 41048 FlyBaseID:FBgn0037627 Length:405 Species:Drosophila melanogaster


Alignment Length:268 Identity:68/268 - (25%)
Similarity:111/268 - (41%) Gaps:50/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PVPGSSQYLDGRCGLLTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVLTAAH--CTRASE 78
            |.|||:....|:         |:..:.||.|.|.|:..:|:.||.:||.:.||||||  ......
  Fly   157 PPPGSTTAAPGQ---------ASFGAYPWQAALLTTADVYLGGGALITAQHVLTAAHKVYNLGLT 212

  Fly    79 QLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFS--KTIRPICI 141
            ....|:||:.....:......:..:|..:::..:|.....||:|||.|:|.:..:  .|:..:|:
  Fly   213 YFKVRLGEWDAASTSEPIPAQDVYISNVYVNPSFNPNNLQNDVAILKLSTPVSLTSKSTVGTVCL 277

  Fly   142 -----VWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFR----------ITDIRRQPANMCSTLN 191
                 |....|           .|.|| .||...:.|::          |.:...|.|...:.|.
  Fly   278 PTTSFVGQRCW-----------VAGWG-KNDFGATGAYQAIERQVDVPLIPNANCQAALQATRLG 330

  Fly   192 GTAILS--SQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQRYVLIGIATTNQKCKRA---SVYTD 250
            .:.:||  |..|||....| .|..|..|||  :.|...:  :.::|:......|.:|   .||.:
  Fly   331 SSFVLSPTSFICAGGEAGKDACTGDGGSPL--VCTSNGV--WYVVGLVAWGIGCAQAGVPGVYVN 391

  Fly   251 VLSHTDFI 258
            |.::..:|
  Fly   392 VGTYLPWI 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 62/249 (25%)
Tryp_SPc 33..258 CDD:304450 62/249 (25%)
CG13318NP_649831.1 Tryp_SPc 169..402 CDD:238113 63/247 (26%)
Tryp_SPc 169..399 CDD:214473 62/245 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435533
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.