DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG18223

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:298 Identity:67/298 - (22%)
Similarity:109/298 - (36%) Gaps:86/298 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LLFLLPV-----PGSSQYLDGRCGLLTNGKIANNISSPWMAYLHTSELL-YV------------- 56
            ||.|||:     |..|.::..|         |..:|||:.....|..|. ||             
  Fly    19 LLLLLPILDAGDPIGSHFVRRR---------AKRLSSPYFDKEKTLVLAKYVVSIRSRRPHKLFG 74

  Fly    57 ----CGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLS------EYQVSQTFIHSL 111
                |||.:|:...:||:|||.....::|.|....:......:.:.|      ..:|.:.|:...
  Fly    75 DNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDK 139

  Fly   112 YNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRKYID-----NIQVLSGAQWG--LPNDRN 169
            : |..:.|:||::.||..:.....:..:      |.....|     |..||.   ||  ......
  Fly   140 F-TVFNTNNIALMMLAKKLPLDNPLVGV------INLPTADPEPGLNYTVLG---WGRIFKGGPL 194

  Fly   170 ESDAFRITDIRRQPANMC--------------STLNGTAILSSQFCAGDSDSKLCNVDFSSPLGA 220
            .||...| |:...|.::|              ..||.|  :....||||:.|.|.   |:..:..
  Fly   195 ASDILHI-DVELLPRDICEKKVHIFKEEMMCAGNLNNT--MDENPCAGDTGSPLI---FNETVFG 253

  Fly   221 IITFKNIQRYVLIGIATTNQKCKRASVYTDVLSHTDFI 258
            :::::       :|..:..    ..|:||:|..|.|:|
  Fly   254 VVSYR-------VGCGSKT----LPSIYTNVYMHMDWI 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 58/269 (22%)
Tryp_SPc 33..258 CDD:304450 58/269 (22%)
CG18223NP_649077.1 Tryp_SPc 60..283 CDD:238113 53/248 (21%)
Tryp_SPc 60..280 CDD:214473 52/246 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437292
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.