DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG7542

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001287099.1 Gene:CG7542 / 39960 FlyBaseID:FBgn0036738 Length:270 Species:Drosophila melanogaster


Alignment Length:246 Identity:62/246 - (25%)
Similarity:109/246 - (44%) Gaps:26/246 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LTNGKIANNISSPWMAYLHTS--ELLYVCGGTVITEKLVLTAAHCTRASEQLVARIGEF-IGTDD 92
            :|||:.|.....|:.|.|:.|  .....||||:|:...::|||||...:|.:...:|.. ||.:.
  Fly    27 ITNGEPAEVGQFPYQAGLNVSFGNWSTWCGGTLISHYWIITAAHCMDGAESVTVYLGAINIGDES 91

  Fly    93 ANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRKY------I 151
            .........:.|...:||.|..:|..|||:::.|...:.|:..||..     ::.|:.      .
  Fly    92 EEGQERIMVEKSGIIVHSNYMASTVVNDISLIRLPAFVGFTDRIRAA-----SLPRRLNGQFPTY 151

  Fly   152 DNIQVLSGAQWGLPNDRNE--SDAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSK-LCNVD 213
            ::|:..:.. ||..:|.::  |...|..::...|.::|......|:.....|...:..| .|:.|
  Fly   152 ESIRAFASG-WGRESDASDSVSPVLRYVEMPIMPHSLCRMYWSGAVSEKMICMSTTSGKSTCHGD 215

  Fly   214 FSSPLGAIITFKNIQRYVLIGIAT--TNQKCKRA--SVYTDVLSHTDFILS 260
            ...||    .:|......|||..:  |:..|:..  :|:|.:.|:.|:||:
  Fly   216 SGGPL----VYKQGNSSYLIGSTSFGTSMGCQVGFPAVFTRISSYLDWILN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 59/240 (25%)
Tryp_SPc 33..258 CDD:304450 59/240 (25%)
CG7542NP_001287099.1 Tryp_SPc 27..263 CDD:238113 62/246 (25%)
Tryp_SPc 27..260 CDD:214473 60/242 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436331
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.