DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG18179

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_648340.1 Gene:CG18179 / 39124 FlyBaseID:FBgn0036023 Length:268 Species:Drosophila melanogaster


Alignment Length:259 Identity:63/259 - (24%)
Similarity:104/259 - (40%) Gaps:41/259 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLPVPGSSQYLDGRCGLLTNGKIANNISSPWMAYL----HTSELLYVCGGTVITEKLVLTAAHCT 74
            |||....|:..:||   :.||..|....:|::..|    ..|....|..||:|....:||||||.
  Fly    26 LLPQVTISEGAEGR---IVNGYPAPEGKAPYIVGLLIRTDGSNSAAVGAGTIIASDWILTAAHCL 87

  Fly    75 RASEQLVARIGEFIGTDDA------NDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFS 133
             .::.:....|...|.:.|      .|..:|         |..: ......||.:: ....:.|:
  Fly    88 -TTDYVEIHYGSNWGWNGAFRQSVRRDNFIS---------HPNW-PAEGGRDIGLI-RTPSVGFT 140

  Fly   134 KTIRPICIVWWTIWR-KYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILS 197
            ..|..:.:..::... :::|...|..|  ||..::.|.:|..:..|::....:.|....|| :.|
  Fly   141 DLINKVALPSFSEESDRFVDTWCVACG--WGGMDNGNLADWLQCMDVQIISNSECEQSYGT-VAS 202

  Fly   198 SQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQRYVLIGIATTNQ-KCKRA-SVYTDVLSHTDFI 258
            :..|...:|.| .|..|...||   :|..|.:   |:|:.|... .|... |.||.|   ||::
  Fly   203 TDMCTRRTDGKSSCGGDSGGPL---VTHDNAR---LVGVITFGSVDCHSGPSGYTRV---TDYL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 57/238 (24%)
Tryp_SPc 33..258 CDD:304450 57/238 (24%)
CG18179NP_648340.1 Tryp_SPc 39..260 CDD:214473 58/246 (24%)
Tryp_SPc 40..263 CDD:238113 57/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435869
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.