DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG33460

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001033949.1 Gene:CG33460 / 3885588 FlyBaseID:FBgn0053460 Length:275 Species:Drosophila melanogaster


Alignment Length:267 Identity:76/267 - (28%)
Similarity:131/267 - (49%) Gaps:19/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SSQYLDGRCGLLTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARI 84
            |:.||..:|||:.. :.:.:: .||.|.|||...:: |.||:||:..:||||.|.|.:...| |:
  Fly    23 SANYLYEQCGLMRE-EFSTSL-GPWTALLHTDGSIF-CAGTLITDVFILTAASCIRPNAVKV-RL 83

  Fly    85 GEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRK 149
            |||   ....:.:..::.|....::.|:|..:.||:|.:|.|...:..:..|.|:||| .....:
  Fly    84 GEF---GRYPNELPEDHLVHYFLMYRLFNNESLANNIGLLKLTKRVQITDYIMPVCIV-LNPQNQ 144

  Fly   150 YIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCAG-DSDSKLCNVD 213
            .:..::.:..| |...::.:.:...|...|:.:| .||:.|:    |.:||||| ..:.:.|:..
  Fly   145 QLSTMRFIGNA-WMEDSNVSLTKELRPIVIQSKP-KMCTNLD----LYTQFCAGHQGNLRSCDGL 203

  Fly   214 FSSPLGAIITFKNIQRYVLIGIATTN-QKCKRASVYTDVLSH---TDFILSVWRQYRNGEKSPKT 274
            ..|.|.....:.|..|::..||||.| ..|:.:..|||||..   ...::|::..|...|.....
  Fly   204 TGSALIQNSRYMNKYRHIQFGIATVNDMDCEESQGYTDVLKFYWWIQDVVSLFNHYSTNESYIVN 268

  Fly   275 WDLQNNF 281
            ..::.||
  Fly   269 DYIKKNF 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/229 (28%)
Tryp_SPc 33..258 CDD:304450 65/229 (28%)
CG33460NP_001033949.1 Tryp_SPc 44..252 CDD:304450 65/219 (30%)
Tryp_SPc 44..249 CDD:214473 65/216 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463266
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.