DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG33465

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001033950.2 Gene:CG33465 / 3885587 FlyBaseID:FBgn0053465 Length:488 Species:Drosophila melanogaster


Alignment Length:276 Identity:80/276 - (28%)
Similarity:126/276 - (45%) Gaps:35/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLFLLPVPGSSQYLDGRCGLLTNGKIANNI--------SSPWMAYLHTSELLYVCGGTVITEKL 66
            ||:.|:...|.:|.||.:|   .:.|.:.||        ::||||.::.:. .::|.||::.:..
  Fly     8 ALIGLVLCQGLAQLLDKKC---HDPKTSENINFNHGATETAPWMASIYKNN-QFICDGTLVHKLF 68

  Fly    67 VLTAAHCTRASEQLVARIGEFIGTDDANDTMLSE-YQVSQTFIHSLYNTTTSANDIAILGLATDI 130
            |||||.|.....||....|.:....||:....:| |.|:....||.:......|||.:|.|..::
  Fly    69 VLTAASCISKDSQLYVLFGMYNQYRDASQFFNNEQYGVAVALQHSNFRPNNGVNDIGLLRLYGEV 133

  Fly   131 VFSKTIRPICIVWWTIWRKYIDNI------QVLSGAQWGLPNDRNESDAFRITDIRRQPANMCST 189
            .....||||||:        :|::      :...|..|........|...:...:.::....|..
  Fly   134 THYAHIRPICII--------LDHVVKSAPFERFEGFGWQQQGTEASSQVRQTVYLSQKKPFECHR 190

  Fly   190 LNG--TAILSSQFCAGDSDSKLCNVDFSSPLGAIITF--KNIQRYVLIGIAT-TNQKCKRASVYT 249
             ||  ..|...|||||:.|...|..:..|||.|..|:  |||.  |.:|:.: .::.|...||||
  Fly   191 -NGQLLPINEGQFCAGNRDRSFCRSNSGSPLTADFTYGVKNIT--VQVGLVSYGSELCSPTSVYT 252

  Fly   250 DVLSHTDFILSVWRQY 265
            ||::..|:|.:..|.:
  Fly   253 DVVAFKDWIYNTVRNF 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 70/244 (29%)
Tryp_SPc 33..258 CDD:304450 70/244 (29%)
CG33465NP_001033950.2 Tryp_SPc 46..264 CDD:238113 68/229 (30%)
Tryp_SPc 46..261 CDD:214473 67/226 (30%)
Tryp_SPc 293..484 CDD:304450
Tryp_SPc 293..481 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463439
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.