DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and sphinx2

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001303408.1 Gene:sphinx2 / 38833 FlyBaseID:FBgn0052382 Length:253 Species:Drosophila melanogaster


Alignment Length:245 Identity:43/245 - (17%)
Similarity:92/245 - (37%) Gaps:35/245 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KIANNISSPWMAYLHTSELLYVCG---------------GTVITEKLVLTAAHCTRASEQLVARI 84
            |::..|:..:.|..:|  ::|:.|               ||:|:.:.:||      ..|.|:.: 
  Fly    21 KLSPRITGGYRAKPYT--IIYLVGIVYAKSPLSSLKFGAGTIISNQWILT------VKEVLIFK- 76

  Fly    85 GEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRK 149
              :|.....:......|.:.:.:..:.|........||::.........:..|.....:...:.:
  Fly    77 --YIEAHFGSKRAFWGYDILRIYRENFYFHYDKTRIIALVKCPYQKFDRRMSRVRVPAYGARFER 139

  Fly   150 YIDNIQVLSGAQWGLPNDRNESDAF-RITDIRRQPANMCSTLNGTAILSSQFC-AGDSDSKLCNV 212
            |:.|:.::.|  ||....:.....: |..::.......|:..: |.:...:.| :|:....:|..
  Fly   140 YVGNMTMVCG--WGTDKRKVRLPTWMRCVEVEVMNNTECAKYH-TPLKWYEMCTSGEGFKGVCEG 201

  Fly   213 DFSSPLGAIITFKNIQRYV-LIGIATTNQKCKRASVYTDVLSHTDFILSV 261
            |..   ||::|......:: :|.:..||......||:..|..|..:|..|
  Fly   202 DMG---GAVVTMGPNPTFIGIIWLMPTNCSIGYPSVHIRVSDHIKWIKHV 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 41/240 (17%)
Tryp_SPc 33..258 CDD:304450 41/240 (17%)
sphinx2NP_001303408.1 Tryp_SPc 25..245 CDD:214473 40/236 (17%)
Tryp_SPc 26..248 CDD:304450 41/238 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.