DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and Jon65Aiii

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_648013.1 Gene:Jon65Aiii / 38683 FlyBaseID:FBgn0035665 Length:274 Species:Drosophila melanogaster


Alignment Length:249 Identity:61/249 - (24%)
Similarity:110/249 - (44%) Gaps:39/249 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GLLTNGKIANNISSPW---MAYLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGT 90
            |.:||||.|.:...|:   :::..||...: |||::|....||||||||..:..:....|..:.|
  Fly    38 GRITNGKTATSGQFPYQVGLSFASTSGSWW-CGGSIIDNTWVLTAAHCTSGASAVTIYYGATVRT 101

  Fly    91 DDANDTMLSEYQVSQTFI-HSLYNTTTSANDIAILGLATDIVFSKTIRPICI--VWWTIWRKYID 152
                ...|.:...:..|: |:.||:....|||:::...| :.|:..|..:.:  :..| :..|..
  Fly   102 ----SAQLVQTVSADNFVQHASYNSIVLRNDISLIKTPT-VAFTALINKVELPAIAGT-YSTYTG 160

  Fly   153 NIQVLSGAQWGLPNDRNES-------DAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSKL- 209
            ...:.||  ||..:|...|       :.|.:..:     :.|....|:.:.::......:.:|: 
  Fly   161 QQAIASG--WGKTSDSATSVANTLQYEVFEVVSV-----SQCQNTYGSLVATNNVICVATPNKVS 218

  Fly   210 -CNVDFSSPLGAIITFKNIQRYVLIGIAT--TNQKCKRASV--YTDVLSHTDFI 258
             ||.|...||..:...|      |||:.:  ::..|:..:.  :|.|.|:.|:|
  Fly   219 TCNGDSGGPLVLVSDSK------LIGVTSFVSSAGCESGAPAGFTRVTSYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 58/243 (24%)
Tryp_SPc 33..258 CDD:304450 58/243 (24%)
Jon65AiiiNP_648013.1 Tryp_SPc 39..266 CDD:214473 59/246 (24%)
Tryp_SPc 40..269 CDD:238113 60/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436232
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.