DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG15873

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_611910.2 Gene:CG15873 / 37898 FlyBaseID:FBgn0035003 Length:297 Species:Drosophila melanogaster


Alignment Length:226 Identity:50/226 - (22%)
Similarity:83/226 - (36%) Gaps:45/226 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 YVCGGTVITEKLVLTAAHC----------TRASEQLVARIGEFIGTDDANDTMLSEYQ-VSQTFI 108
            :.|.|.:::.:.|||||||          .|....:...|......|:      |::: |.:..:
  Fly    67 HFCSGVLVSSRAVLTAAHCLTDRYKASMNPRGIRVVFGHITRLAVYDE------SDFRSVDRLVV 125

  Fly   109 HSLYNTTTSANDIAILGLATDIVFSK-TIRPICIVWWTIWRK-----YIDNIQVLSGAQWG-LPN 166
            |..|. ....||:|||.|:..:..|. .:.|:      :.||     |.|....|.   || :..
  Fly   126 HPEYE-RYKKNDLAILRLSERVQSSNHDVLPL------LMRKTANVTYGDTCITLG---WGQIYQ 180

  Fly   167 DRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCAGD-SDSKLCNVDFSSPLGAIITFKNIQRY 230
            ....|:.....|:..:|.::|.....|.......|... .:|..|..|...||        :.:.
  Fly   181 HGPYSNELVYLDVILRPPSLCQKHYDTFTADHNVCTEPVGESMNCAGDMGGPL--------LCKG 237

  Fly   231 VLIGIATTNQKCK--RASVYTDVLSHTDFIL 259
            .|.|:...:..|.  :|..:...|.:.|:||
  Fly   238 ALFGLIGGHMGCAGGKAMKFLSFLYYKDWIL 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 48/223 (22%)
Tryp_SPc 33..258 CDD:304450 48/223 (22%)
CG15873NP_611910.2 Tryp_SPc 36..250 CDD:214473 44/206 (21%)
Tryp_SPc 59..250 CDD:238113 44/206 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436727
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.