DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG13527

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001286744.1 Gene:CG13527 / 37615 FlyBaseID:FBgn0034776 Length:292 Species:Drosophila melanogaster


Alignment Length:287 Identity:64/287 - (22%)
Similarity:102/287 - (35%) Gaps:94/287 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LLTNGKIANNISSPWMAYLHTSELL----YV-----------------CGGTVITEKLVLTAAHC 73
            :|:.......:|||   ..|..|.|    ||                 |||.:::.:.|:|||||
  Fly    17 ILSGAHRMKRLSSP---KFHGDETLELAKYVVSIRSRTPNKYFGDNHYCGGGLLSNQWVITAAHC 78

  Fly    74 TRASEQLVARIGEFIGTDDANDTM-----------LSEYQVSQTF-IHSLYNTT-------TSAN 119
            .....:::.:....:....:...:           :|...|.:.| :|:.:|..       ..:|
  Fly    79 VMGQSKIMYKARWLLVVAGSPHRLRYTPGKSVCSPVSSLYVPKNFTMHNTFNMALMKLQEKMPSN 143

  Fly   120 D--IAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRI--TDIR 180
            |  |..|.|..:.. ...||...:.|..::              :|.|.      |..|  .|:.
  Fly   144 DPRIGFLHLPKEAP-KIGIRHTVLGWGRMY--------------FGGPL------AVHIYQVDVV 187

  Fly   181 RQPANMCSTL---NGTAILSSQFCAGDS----DSKLCNVDFSSPL--GAIITFKNIQRYVLIGIA 236
            .....:|.|.   .|..::    |||::    |::.|:.|..|||  |.::.  .|..|. ||..
  Fly   188 LMDNAVCKTYFRHYGDGMM----CAGNNNWTIDAEPCSGDIGSPLLSGKVVV--GIVAYP-IGCG 245

  Fly   237 TTNQKCKRASVYTDVLS------HTDF 257
            .||    ..||||||.|      ||.:
  Fly   246 CTN----IPSVYTDVFSGLRWIRHTAY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 63/284 (22%)
Tryp_SPc 33..258 CDD:304450 63/284 (22%)
CG13527NP_001286744.1 Tryp_SPc 43..266 CDD:238113 55/254 (22%)
Tryp_SPc 43..263 CDD:214473 55/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.