DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG30283

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_611587.2 Gene:CG30283 / 37454 FlyBaseID:FBgn0260477 Length:273 Species:Drosophila melanogaster


Alignment Length:270 Identity:75/270 - (27%)
Similarity:134/270 - (49%) Gaps:20/270 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVIGISALLFLLPVPGSSQYLDGRCGL-------LTNGKIANNISSPWMAYLHTSELLYVCGGTV 61
            |::..|:::.|....||  :|:..||.       :..|..|...|:||||.: ..|..:.||||:
  Fly    11 VLLAASSVVVLGSESGS--FLEHPCGTVPISQFKILGGHNAPVASAPWMAMV-MGEGGFHCGGTL 72

  Fly    62 ITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGL 126
            ||.:.|||:|||. |:.:|..|:|..     ..:....::.|...|:|:.|  ....:|:|:|.|
  Fly    73 ITNRFVLTSAHCI-ANGELKVRLGVL-----EREAEAQKFAVDAMFVHTDY--YFDQHDLALLRL 129

  Fly   127 ATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCS-TL 190
            |..:.:|..|.|||::...:.:...::|.......||....|:.|...:.|.:.....:.|: ..
  Fly   130 AKRVHYSDNISPICLLLDPLVKNIDEHIVKFRTYGWGKTESRSSSRMLQKTSLFNLHRSECAKQY 194

  Fly   191 NGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKCKRASVYTDVLSH 254
            ....|..:..||..:::..||.|...||.||:|:.::|.....|:.: .:..|.:|:|:|:|::|
  Fly   195 PHQQINRNHICAESANANTCNGDSGGPLTAIVTYDHVQMVFQFGVTSFGHADCSKATVFTNVMTH 259

  Fly   255 TDFILSVWRQ 264
            .|:|::..|:
  Fly   260 LDWIVNTVRR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/226 (29%)
Tryp_SPc 33..258 CDD:304450 65/226 (29%)
CG30283NP_611587.2 Tryp_SPc 42..263 CDD:214473 65/229 (28%)
Tryp_SPc 43..266 CDD:238113 66/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.