DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and scaf

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_610180.1 Gene:scaf / 35505 FlyBaseID:FBgn0033033 Length:655 Species:Drosophila melanogaster


Alignment Length:212 Identity:56/212 - (26%)
Similarity:91/212 - (42%) Gaps:45/212 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ANNISSPWMA-YLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARI--GEF-IGTDDANDTM 97
            ||....||.| .|..|....:|||.:|.::.||::|.|.........|:  ||: :|:  .|:.:
  Fly   429 ANFAEIPWQAMILRESSKTLICGGAIIGDQFVLSSASCVNGLPVTDIRVKAGEWELGS--TNEPL 491

  Fly    98 LSEYQ---VSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICI----------VWWTIWRK 149
              .:|   |....:|..|:.:|:::|:||:.|...:.|:..|:||||          .:.:.|.|
  Fly   492 --PFQLTGVKTVDVHPDYDPSTNSHDLAIIRLERRLEFASHIQPICISDEDPKDSEQCFTSGWGK 554

  Fly   150 YIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCAGDSDSKLCNVDF 214
                 |.||        ...|.....:||...|..:.||..:.:...:::|     ||  |..|.
  Fly   555 -----QALS--------IHEEGALMHVTDTLPQARSECSADSSSVCSATKF-----DS--CQFDV 599

  Fly   215 SSPL----GAIITFKNI 227
            .|.|    |:.:..|.|
  Fly   600 GSALACGSGSSVRLKGI 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 56/212 (26%)
Tryp_SPc 33..258 CDD:304450 56/212 (26%)
scafNP_610180.1 FtsK <198..>334 CDD:332908
Tryp_SPc 428..616 CDD:238113 55/210 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435500
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.