DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG17572

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:275 Identity:71/275 - (25%)
Similarity:108/275 - (39%) Gaps:64/275 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 CG-LLTNGKIANNISS-PWMA-----YLHTSELLYVCGGTVITEKLVLTAAHCTRASEQ----LV 81
            || .|..|.....:.| |::|     :::|....|.|.|.||..:::||||||..|...    ..
  Fly   124 CGKSLVQGHFYKGLGSYPFVARIGFKHVNTGAFAYPCAGAVIARRVILTAAHCALAKADGHRLSS 188

  Fly    82 ARIGEFIGTDD---ANDTMLS----EYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPI 139
            .|:||:..:.|   ||....:    .:.:|...:|..|......:|||:|.|.|.:.:|...:||
  Fly   189 VRVGEYDTSSDPDCANTGFCAPRSVNHAISHVIVHPDYKQGQYHHDIALLVLKTPLNYSVATQPI 253

  Fly   140 CIVWWTIWRKYIDNIQV---LSGAQWGLPNDRNESDAFRITDIRRQPA-----------NMC-ST 189
            |:      :|...|:.|   .:.|.||..:          |...|||.           ::| ..
  Fly   254 CL------QKTRANLVVGKRATIAGWGKMS----------TSSVRQPEMSHLDVPLTSWDLCLRN 302

  Fly   190 LNGTAILSSQ-------FCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKC---K 243
            ...|..|.|.       .|||.....:|.....:||  .|....|  :..|||.: .:..|   :
  Fly   303 YGSTGALESPNSIEGQWMCAGGEGKDVCQGFGGAPL--FIQENGI--FSQIGIMSFGSDNCGGLR 363

  Fly   244 RASVYTDVLSHTDFI 258
            ..||||.|...:::|
  Fly   364 IPSVYTSVAHFSEWI 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 67/267 (25%)
Tryp_SPc 33..258 CDD:304450 67/267 (25%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 67/261 (26%)
Tryp_SPc 138..378 CDD:214473 66/259 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.