DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG9377

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster


Alignment Length:292 Identity:70/292 - (23%)
Similarity:117/292 - (40%) Gaps:84/292 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PWMAYLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARI--GEFIGTDDANDTMLSEYQVSQ 105
            ||:..::.|: .|:|.|.:||...|:|.|||.:.||....|:  ||:....:.......:..|.:
  Fly   113 PWLVAVYGSD-TYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVE 176

  Fly   106 TFIHSLYNTTTSANDIAILGLATDIVF--SKTIRPICI----VWWTIWRKYIDNIQVLSGAQWGL 164
            |.:|..|.....|::||||.:..:..|  :..::|||:    :.:...:.|:      ||.|   
  Fly   177 TLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCYV------SGWQ--- 232

  Fly   165 PNDRNESDAFRITDIRRQ------PANMCSTLNGTAIL-------SSQFCA-GDSDSKLC-NVDF 214
                 .||..|...:.::      |.:.|.|....::|       .|..|| ||....:| :||.
  Fly   233 -----RSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDM 292

  Fly   215 SS-----PLGAIITFKNIQRYVLIGIATTNQKC---KRASVYTDVLSHTDFILSVWRQYRNGEKS 271
            ::     ||..     :..|:.|.|:.|...:|   :...:||:|        .::||       
  Fly   293 TAVPLMCPLSG-----HDDRFHLAGLLTRTARCDGPQLLGIYTNV--------KLYRQ------- 337

  Fly   272 PKTW-DL---QNNFDVENTTLKANSEEEHYFV 299
               | ||   :.|.|:           .||.|
  Fly   338 ---WIDLKLRERNLDI-----------RHYMV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 60/245 (24%)
Tryp_SPc 33..258 CDD:304450 60/245 (24%)
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 63/264 (24%)
Tryp_SPc 105..339 CDD:214473 62/263 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435467
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.