DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and Jon25Bi

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster


Alignment Length:262 Identity:62/262 - (23%)
Similarity:94/262 - (35%) Gaps:71/262 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GLLTNGKIANNISSPWMAYL-HTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARIG------- 85
            |.:.||..|....:|:...| .:....:.|||::|....||||||||..:.|:....|       
  Fly    35 GRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNA 99

  Fly    86 EFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRK- 149
            :|..|..:.|           ||.:......:.||||:            ||...:.:|.:..| 
  Fly   100 QFTHTVGSGD-----------FIQNHNWPNQNGNDIAL------------IRTPHVDFWHMVNKV 141

  Fly   150 ----------YIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGT---AILSSQFC 201
                      ..||...:: ..|||....::.|.....|::....:.||...||   .||    |
  Fly   142 ELPSFNDRYNMYDNYWAVA-CGWGLTTAGSQPDWMECVDLQIISNSECSRTYGTQPDGIL----C 201

  Fly   202 AGDSDSK-LCNVDFSSPL-----GAIITFKNIQRYVLIGIAT--TNQKCKRA--SVYTDVLSHTD 256
            ...|..| .|:.|...||     |.           |:|:.:  :...|...  |.:|.|.:..|
  Fly   202 VSTSGGKSTCSGDSGGPLVLHDGGR-----------LVGVTSWVSGNGCTAGLPSGFTRVTNQLD 255

  Fly   257 FI 258
            :|
  Fly   256 WI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 60/256 (23%)
Tryp_SPc 33..258 CDD:304450 60/256 (23%)
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 60/259 (23%)
Tryp_SPc 37..260 CDD:238113 61/260 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435935
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.