DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and sphe

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:288 Identity:68/288 - (23%)
Similarity:113/288 - (39%) Gaps:88/288 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VIGISALLFLLPVPGSSQYLDGRC---GLLTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKL 66
            :||::|:              |.|   |.:..|:.|:..::.:.|.|.... .:||||:::::..
  Fly    11 LIGLTAV--------------GMCHAQGRIMGGEDADATATTFTASLRVDN-AHVCGGSILSQTK 60

  Fly    67 VLTAAHCTRA------SEQLVARIG---EFIGTDDANDTMLSEYQVSQTFIH-SLYNTTTSANDI 121
            :||.|||...      :.:|..|:|   ::.|....|        |....:| ..||..   |::
  Fly    61 ILTTAHCVHRDGKLIDASRLACRVGSTNQYAGGKIVN--------VESVAVHPDYYNLN---NNL 114

  Fly   122 AILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSG------------AQWGLPNDRNESDAF 174
            |::.|::::.::..|..|.:              |.||            |.||..:|...|...
  Fly   115 AVITLSSELTYTDRITAIPL--------------VASGEALPAEGSEVIVAGWGRTSDGTNSYKI 165

  Fly   175 RITDIRRQPANMCSTLNGTAILSSQ-FC-AGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT 237
            |...::..|...|  |:..:....| || |.:.....|:.|...  |||  :.|    .|||:  
  Fly   166 RQISLKVAPEATC--LDAYSDHDEQSFCLAHELKEGTCHGDGGG--GAI--YGN----TLIGL-- 218

  Fly   238 TN---QKCKRASVYTDVL----SHTDFI 258
            ||   ..|  .|.|.||.    |:.|:|
  Fly   219 TNFVVGAC--GSRYPDVFVRLSSYADWI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 61/255 (24%)
Tryp_SPc 33..258 CDD:304450 61/255 (24%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 59/243 (24%)
Tryp_SPc 42..244 CDD:214473 58/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.