DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG31220

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:298 Identity:74/298 - (24%)
Similarity:114/298 - (38%) Gaps:79/298 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PVPGSS--QYLDGRCG--LLTN---GKIANNISS-PWMA---YLHTS------ELLYVCGGTVIT 63
            |.|.::  .|.|  ||  ..||   |....|::. ||:|   |.:.|      ||:..|||::|.
  Fly    83 PKPANTLPSYPD--CGKPQTTNRVIGGTEPNLNEYPWLAMLLYRNRSAFNPDRELVPSCGGSLIN 145

  Fly    64 EKLVLTAAHCTRASEQLV--ARIGEFIGTDDANDTMLS------------EYQVSQTFIHSLYNT 114
            .:.|||||||...:...:  .|:||.  |...|...:|            :..|.....|:.|:.
  Fly   146 TRYVLTAAHCVTDTVLQIQRVRLGEH--TTSHNPDCISRGARIVCAPTHLDIDVESITSHNDYDP 208

  Fly   115 T--TSANDIAILGLATDIVFSKTIRPICIVWW----TIWRKYIDNIQVLSGAQWGLPN--DRNES 171
            .  |..||||::.|...:.::....|||::.:    ..::.|:        |.||...  |.. |
  Fly   209 ANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKFKMYV--------AGWGKTGMFDTG-S 264

  Fly   172 DAFRITDIRRQPANMCSTLNGTAILSSQF--CAGDSDSK-LCNVDFSSPLGA-------IITFKN 226
            ...:...::.:....||..........:|  |||..|:: .|:.|..|||..       .|||  
  Fly   265 KVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGDSGSPLMGTSGRSYETITF-- 327

  Fly   227 IQRYVLIGIATTNQKC----------KRASVYTDVLSH 254
                 |.||.:....|          :.|..|..:.:|
  Fly   328 -----LAGITSYGGPCGTIGWPSVFTRTAKFYKWIRAH 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 67/277 (24%)
Tryp_SPc 33..258 CDD:304450 67/277 (24%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 65/271 (24%)
Tryp_SPc 104..360 CDD:238113 65/273 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463635
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.