DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG8952

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:278 Identity:76/278 - (27%)
Similarity:113/278 - (40%) Gaps:45/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SALLFLL-----------PVPGSSQYLDGRCGLLTNGKIANNISSPWMAYLHT---SELLYVCGG 59
            |.:|.||           |...|...:|.|   :.:|..|.....||...|..   .:||  |||
  Fly     8 SLMLVLLAAISVVGQPFDPANSSPIKIDNR---IVSGSDAKLGQFPWQVILKRDAWDDLL--CGG 67

  Fly    60 TVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAIL 124
            ::|::..||||||||..    ::.|....||.|..:........:...||..||...: ||::::
  Fly    68 SIISDTWVLTAAHCTNG----LSSIFLMFGTVDLFNANALNMTSNNIIIHPDYNDKLN-NDVSLI 127

  Fly   125 GLATDIVFSKTIRPICIVWWTIWRKYIDNI----QVLSGAQWGLPNDR--NESDAFRITDIRRQP 183
            .|...:.||..|:.|.:|     .:|.|:|    .|.:.|.:|...|.  :.|:......:....
  Fly   128 QLPEPLTFSANIQAIQLV-----GQYGDSIDYVGSVATIAGFGYTEDEYLDYSETLLYAQVEIID 187

  Fly   184 ANMCSTLNGT-AILSSQFCA---GDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT--TNQKC 242
            ...|..:.|. .::.|..||   ..||...|..|...||  |:..|.||::..|||.:  ...:|
  Fly   188 NADCVAIYGKYVVVDSTMCAKGFDGSDMSTCTGDSGGPL--ILYNKTIQQWQQIGINSFVAEDQC 250

  Fly   243 --KRASVYTDVLSHTDFI 258
              :..|.|..|.|...||
  Fly   251 TYRLPSGYARVSSFLGFI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 66/241 (27%)
Tryp_SPc 33..258 CDD:304450 66/241 (27%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 67/247 (27%)
Tryp_SPc 38..271 CDD:238113 68/245 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.