DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG31269

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster


Alignment Length:290 Identity:69/290 - (23%)
Similarity:110/290 - (37%) Gaps:71/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVIGISALLFL--LPVPGSSQ----YLDGRCGLLTNGKIANNISSPWMAYLHTSELLYVCGGTVI 62
            :::|:|.|:.:  :.:.|:|.    |.|.|   :..|:.|.:..:|:...|......:.|||.:|
  Fly     8 ILLGLSGLVSITAIRIKGNSTDGRFYKDQR---IIGGQAAEDGFAPYQISLQGISGAHSCGGAII 69

  Fly    63 TEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLA 127
            .|..|||||||  .....:..:....||:..|... ..|.:....||..|:.....||||:|.|.
  Fly    70 NETFVLTAAHC--VENAFIPWLVVVTGTNKYNQPG-GRYFLKAIHIHCNYDNPEMHNDIALLELV 131

  Fly   128 TDIVFSKTIRPICI----------VWWTIWRKYIDNIQVLSGAQWGL-PNDRNESDAFRITDIRR 181
            ..|.:.:..:||.:          |..|.|.         |...||. |.|      .::..::.
  Fly   132 EPIAWDERTQPIPLPLVPMQPGDEVILTGWG---------STVLWGTSPID------LQVLYLQY 181

  Fly   182 QPANMCSTLNGTAILSSQFCAGDSD---------SKL----CNVDFSSPLGAIITFKNIQRYVLI 233
            .|...|.     |:||:     |.|         |:|    |:.|...||        :....|:
  Fly   182 VPHRECK-----ALLSN-----DEDCDVGHICTFSRLGEGACHGDSGGPL--------VSNGYLV 228

  Fly   234 GIATTNQKCKRA--SVYTDVLSHTDFILSV 261
            |:......|...  .|:..|..:.|:|.:|
  Fly   229 GLVNWGWPCATGVPDVHASVYFYRDWIRNV 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 59/250 (24%)
Tryp_SPc 33..258 CDD:304450 59/250 (24%)
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 60/256 (23%)
Tryp_SPc 38..258 CDD:238113 60/255 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.