DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and spirit

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:266 Identity:73/266 - (27%)
Similarity:112/266 - (42%) Gaps:39/266 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PWMAYL-----HTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQ 102
            |:||.|     ....:.|.|||.:|....|||||||.....:..:::.  :|.|:...|...:..
  Fly   144 PFMAALGWRSNFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVR--LGGDNLTLTEGEDIS 206

  Fly   103 VSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPND 167
            :.:..||..|:.:|:.||||:|.|.|  .....::|.||  ||  :|.:.| .:::...:|..:.
  Fly   207 IRRVIIHPDYSASTAYNDIALLELET--AAKPELKPTCI--WT--QKEVTN-TLVTAIGYGQTSF 264

  Fly   168 RNESDAFRITDIRRQPANMCSTLN----------GTAILSSQFCAGD--SDSKLCNVDFSSPLGA 220
            ...|.|    .:.:.|....|...          ...:|.:|.||||  .:...|..|...||  
  Fly   265 AGLSSA----QLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPL-- 323

  Fly   221 IITFKNIQRYVLIGIATTNQKCKRA--SVYTDVLSHTDFILS-VW--RQYRNGEKSPKTWDLQNN 280
             :....:..|| :||.:..|.|...  ||||.|.|..|:|.. ||  :|..|..:..:.......
  Fly   324 -LMQDGLLGYV-VGITSLGQGCASGPPSVYTRVSSFVDWIEGIVWPAQQVTNAPQPNQMTSFSPE 386

  Fly   281 FDVENT 286
            ||:..|
  Fly   387 FDLRAT 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/233 (28%)
Tryp_SPc 33..258 CDD:304450 65/233 (28%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829
Tryp_SPc 132..364 CDD:238113 66/236 (28%)
Tryp_SPc 132..361 CDD:214473 65/233 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.