DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and Sp212

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_996209.2 Gene:Sp212 / 2768666 FlyBaseID:FBgn0053329 Length:516 Species:Drosophila melanogaster


Alignment Length:235 Identity:60/235 - (25%)
Similarity:108/235 - (45%) Gaps:31/235 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PWMAYLHTSE---LLYVCGGTVITEKLVLTAAHCTR--ASEQLVARIGEFIGTDDANDTMLSEYQ 102
            ||::.::..|   |.:.|.|::|:..:|::||||..  ..:::|..:|.: ..||..:.......
  Fly   289 PWLSAVYHKEVRALAFKCRGSLISSSIVISAAHCVHRMTEDRVVVGLGRY-DLDDYGEDGAEMRN 352

  Fly   103 VSQTFIHSLYNTTT-SANDIAILGLATDIVFSKTIRPICIVWWTI-WRKYIDNIQVLSGAQWGLP 165
            |.:...|..|||.: |..|||::.:...:.|:..|.|||:  ||: ..:.:.....::|  ||..
  Fly   353 VMRLLWHPDYNTRSYSDADIALITIERPVTFNDIIAPICM--WTVEASRTVSTTGFIAG--WGRD 413

  Fly   166 NDRNESDAFRITDIRRQPANMC-STLNGTAILSSQFCAGDSDSKLCNVDFSSPL----GAIITFK 225
            .|.:.:...|:.:.......:| ||..||.:.....|||       |.|.|.|.    |..:..|
  Fly   414 EDSSRTQYPRVVEAEIASPTVCASTWRGTMVTERSLCAG-------NRDGSGPCVGDSGGGLMVK 471

  Fly   226 NIQRYVLIGIATTNQK-----CK--RASVYTDVLSHTDFI 258
            ...|::|.||.:..::     |:  :..:|.|:..|.::|
  Fly   472 QGDRWLLRGIVSAGERGPAGTCQLNQYVLYCDLSKHINWI 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 59/233 (25%)
Tryp_SPc 33..258 CDD:304450 59/233 (25%)
Sp212NP_996209.2 GD_N 23..122 CDD:292649
Tryp_SPc 277..514 CDD:238113 60/235 (26%)
Tryp_SPc 277..511 CDD:214473 59/233 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.