DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG30286

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:275 Identity:87/275 - (31%)
Similarity:134/275 - (48%) Gaps:30/275 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISALLFLLP--VPGSSQYLDGRCGLLTNGKIAN-----NIS-SPWMAYLHTSELLYVCGGTVITE 64
            |..|..|||  ...::|:|:..||.::...:.|     :|| ||||||||.|..| |||||::..
  Fly     4 ILLLTSLLPWHPHATAQFLEPDCGYMSPEALQNEEHQAHISESPWMAYLHKSGEL-VCGGTLVNH 67

  Fly    65 KLVLTAAHCTRASEQLVARIGEF--IGTDDANDT----MLSEYQVSQTFIHSLYNTTTSANDIAI 123
            :.:||||||.|..|.|..|:|||  :.:.|.|.:    ...::::...|.|..|:.|...:||.:
  Fly    68 RFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSDCLPPSEDFEIDVAFRHGGYSRTNRIHDIGL 132

  Fly   124 LGLATDIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDA-------FRITDIRR 181
            |.||..:.:...|:|||::..|..:..|:.:..|....||    |:.|:|       .|:|   |
  Fly   133 LRLAKSVEYKVHIKPICLITNTTLQPKIERLHRLVATGWG----RSPSEAANHILKSIRVT---R 190

  Fly   182 QPANMCSTLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKCKRA 245
            ....:||..........|.|........|:.|...|:|..|.......:|.:||.: .|.:|...
  Fly   191 VNWGVCSKTYWVDRRRDQICVSHESGVSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAECLSP 255

  Fly   246 SVYTDVLSHTDFILS 260
            ||:|:|:.|.|:|::
  Fly   256 SVFTNVMEHIDWIMA 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 77/244 (32%)
Tryp_SPc 33..258 CDD:304450 77/244 (32%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 76/237 (32%)
Tryp_SPc 39..268 CDD:214473 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463271
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.