DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG30091

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_725484.1 Gene:CG30091 / 246449 FlyBaseID:FBgn0050091 Length:526 Species:Drosophila melanogaster


Alignment Length:258 Identity:82/258 - (31%)
Similarity:123/258 - (47%) Gaps:20/258 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GSSQYLDGRCGL-------LTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVLTAAHCTRA 76
            ||::.||..||:       :..|..|..:.:||||.:.|:: .::|||:|||.|.|||||||...
  Fly    18 GSARLLDEDCGVPMQLIPKIVGGVDAGELKNPWMALIKTND-EFICGGSVITNKFVLTAAHCMCT 81

  Fly    77 SE-------QLVARIGEF--IGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVF 132
            .|       ||...:|.:  :.|.:.|... ..|.|.:.:||..:......||||:|.|...||:
  Fly    82 DEECIVKYTQLTVTLGVYHLLATGEHNHPH-EIYNVERVYIHDSFAIQNYRNDIALLRLQKSIVY 145

  Fly   133 SKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILS 197
            ...|:|:||:.....:...|.||..:...||:..:...|:..::..|.|....||..........
  Fly   146 KPQIKPLCILLNDQLKPQTDLIQEFTAIGWGVTGNGKMSNNLQMVKIYRIDRKMCEAAFWYTFDY 210

  Fly   198 SQFCAGDSDSK-LCNVDFSSPLGAIITFKNIQRYVLIGIATT-NQKCKRASVYTDVLSHTDFI 258
            ..||||.:..: .|..|...||...:.|..|:|...:||.:| .:.|:...:||||:.|.|||
  Fly   211 PMFCAGTAVGRDTCKRDSGGPLYIHMLFDGIKRATQLGIVSTGTEDCRGFGMYTDVMGHIDFI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 74/235 (31%)
Tryp_SPc 33..258 CDD:304450 74/235 (31%)
CG30091NP_725484.1 Tryp_SPc 36..273 CDD:214473 74/238 (31%)
Tryp_SPc 37..276 CDD:238113 76/239 (32%)
Trypsin 310..520 CDD:278516
Tryp_SPc 313..520 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.