DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and Proc

DIOPT Version :10

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:XP_006525784.1 Gene:Proc / 19123 MGIID:97771 Length:484 Species:Mus musculus


Alignment Length:56 Identity:12/56 - (21%)
Similarity:25/56 - (44%) Gaps:9/56 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 LTARVK-IGCSVRELTEFYR-NCYDLENLIACFDSRD-------KFLIAETRHYVG 347
            |::|.| |....:|:.:.|| :|.....::.....:|       :|.:.:..|.:|
Mouse   186 LSSRSKAIASKTKEIEQVYRQDCETFGMVVKMLIEKDPSLEKSIQFALRQNLHEIG 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473
ProcXP_006525784.1 GLA 50..110 CDD:214503
EGF_CA 111..155 CDD:238011
FXa_inhibition 163..198 CDD:464251 4/11 (36%)
Tryp_SPc 236..470 CDD:238113 2/6 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.