DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and try-4

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:283 Identity:64/283 - (22%)
Similarity:104/283 - (36%) Gaps:94/283 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISALLFLLPVP---------GS------------SQYLDGRCGLLTNGKIANNISSPWMAYLHTS 51
            |:||:.:..||         |:            ::.|...||:....||.|   .|| |...|.
 Worm     6 ITALIIIFTVPVITFEPVWIGNAFSMESFQTIVDNEVLMESCGIQQESKIKN---FPW-AVSFTV 66

  Fly    52 ELLYVCGGTVITEKLVLTAAH------------CTRAS-----------------EQLVARIGEF 87
            :.:...||::|:...::||||            |...:                 .:.||..|..
 Worm    67 DGVNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRSIKFLRDTRKVAYGGTC 131

  Fly    88 I-GTDD--ANDTMLSEYQVSQTFIHSLY-------NTTTSANDIAILGLATDIVFSKTIRPICI- 141
            | |..|  .||....:..|....:.::.       :.....:|.||:.:...|.||:.:||||: 
 Worm   132 IRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEVEKRIHFSENVRPICLP 196

  Fly   142 ---VWWTIWRKYIDNIQVLSGAQWGLPNDRNESD------AFRI-TDIRRQ-----PAN----MC 187
               :::|         :.|:...||.....|||.      ..|| .|.:|.     ||:    :|
 Worm   197 RPNMYYT---------KSLAVPGWGRSYIFNESGPLIHEIPMRIDRDCKRPWSDRLPADADDFIC 252

  Fly   188 ST-LNGTAILSSQFCAGDSDSKL 209
            :| :|.:...:.:.|.|||...|
 Worm   253 ATSMNVSNYSAPRTCHGDSGGGL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 55/237 (23%)
Tryp_SPc 33..258 CDD:304450 55/237 (23%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 55/238 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.