DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and try-3

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:278 Identity:71/278 - (25%)
Similarity:113/278 - (40%) Gaps:57/278 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFLLPVPGSSQYLDGRCGLLTNGKIANNISSPWMAYLHTSELLY-------VCGGTVITEKLVLT 69
            :|...:.|.:...||          ||     |||.|    :.|       :||.|||.:..::|
 Worm    33 IFSFRIIGGNSIDDG----------AN-----WMAKL----VSYGDNGQGILCGATVIDDFWLVT 78

  Fly    70 AAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSK 134
            ||||   :.||..|  .|:...:..:.....:.|.:.:|||.||..|:.||||:|.:::|:  ||
 Worm    79 AAHC---ALQLQTR--SFVYVREPKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISSDL--SK 136

  Fly   135 T-IRPICIVW--WTIWRKYIDNIQVLSGAQWGLPNDRN----ESDAFRITDIRRQPANMC----- 187
            . |:|:|:|.  ..:.::|.:.:.:..|...|..:...    .|...:.|.:.....:.|     
 Worm   137 LGIKPVCLVHDDSKLLKQYKNGVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWR 201

  Fly   188 -STLNGTAILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIATTN--------QKCK 243
             .:|....|...|.|||.........|...||   :..|:...||.|||.:..        .:.|
 Worm   202 FLSLLSVKITGYQICAGAYLHGTAPGDSGGPL---LIHKSNGEYVQIGITSYGADGLDGVIDQGK 263

  Fly   244 RASVYTDVLSHTDFILSV 261
            ...|||.:..:..:|..|
 Worm   264 FPGVYTRISKYVPWIQGV 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 65/252 (26%)
Tryp_SPc 33..258 CDD:304450 65/252 (26%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 68/269 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.