DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG43742

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001261130.1 Gene:CG43742 / 14462622 FlyBaseID:FBgn0263999 Length:474 Species:Drosophila melanogaster


Alignment Length:257 Identity:74/257 - (28%)
Similarity:120/257 - (46%) Gaps:36/257 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQYLDGRCGLLTNGKIANN---ISSPWMAYLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVA 82
            :|.||..|.:....::||.   |:|.:||.|:.:...: |||::|.::.|||||||.|..:::..
  Fly    20 AQLLDENCKVKITYRVANGHTAITSQFMAALYNNSEFF-CGGSLIHKQYVLTAAHCVRDLDEVTV 83

  Fly    83 RIGEFIGTDDANDTMLSEYQV---SQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWW 144
            .:||   .:.:....:.::.:   ::..:|..::.....||||:|.|..:::|...||||||:  
  Fly    84 HLGE---NNRSCPIPVCKHVLRLNAKVILHPNFHGNIFLNDIALLRLEREVIFEAHIRPICII-- 143

  Fly   145 TIWRKYIDNIQVLSGAQ-------WGLPNDRNESDAFRITDIRRQPANMC-STLNGTAILSSQFC 201
                  :|. .|.|..|       ||.....|.||.....|:.|.|.:|| ..:|       ..|
  Fly   144 ------LDE-DVTSNNQNNFTAYGWGKTEHGNISDVLSFIDLVRLPKSMCYQNIN-------TIC 194

  Fly   202 AGDSDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKCKRA-SVYTDVLSHTDFILSV 261
            ||.:....|..|...||......:...|.:|.||.: .:.:|... .|||||.::..:|.||
  Fly   195 AGSTSGDTCESDSGGPLIGNFVHRGKSRDILFGITSYGDAECSGLFGVYTDVNAYKSWIASV 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 67/240 (28%)
Tryp_SPc 33..258 CDD:304450 67/240 (28%)
CG43742NP_001261130.1 Tryp_SPc 34..253 CDD:214473 67/238 (28%)
Tryp_SPc 35..256 CDD:238113 68/240 (28%)
Tryp_SPc 273..467 CDD:214473
Tryp_SPc 273..>368 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.