DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG43110

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001246396.1 Gene:CG43110 / 12798330 FlyBaseID:FBgn0262570 Length:483 Species:Drosophila melanogaster


Alignment Length:255 Identity:72/255 - (28%)
Similarity:121/255 - (47%) Gaps:28/255 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SQYLDGRCG-----LLTNGKIANNISSPWMA-YLHTSELLYVCGGTVITEKLVLTAAHCTRASEQ 79
            |.:|...||     .:.:|..|:..|:.:|| ..:|:.||  ||||:|.|..|||.||| ::::.
  Fly    21 SMFLKQPCGKTPVPKIISGSNASQQSAQYMAGIFNTTHLL--CGGTIIHEDFVLTVAHC-KSTQT 82

  Fly    80 LVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWW 144
            |..|:|.: ..:...|    :.:|.:|..|..|:.:|.|||||::.|...::|:..|:||||   
  Fly    83 LFVRLGAY-NINHPTD----QIRVIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICI--- 139

  Fly   145 TIWRKYID-----NIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILSSQFCAGD 204
                 ::|     .|:..:...||...:..:||..:...:.|....:|....|.:....|.||..
  Fly   140 -----HLDATLGKQIRYYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATT 199

  Fly   205 SDSKLCNVDFSSPLGAIITFKNIQRYVLIGIAT-TNQKCKRASVYTDVLSHTDFILSVWR 263
            .....|..|...||.:.||::........||.: ..::|....:||||..::.:|.::.|
  Fly   200 DQGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQYSGWIANIVR 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 66/231 (29%)
Tryp_SPc 33..258 CDD:304450 66/231 (29%)
CG43110NP_001246396.1 Tryp_SPc 35..254 CDD:214473 66/234 (28%)
Tryp_SPc 36..257 CDD:238113 67/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463434
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.