DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG43125

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001247344.1 Gene:CG43125 / 12798281 FlyBaseID:FBgn0262588 Length:258 Species:Drosophila melanogaster


Alignment Length:269 Identity:70/269 - (26%)
Similarity:118/269 - (43%) Gaps:44/269 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SVVIGISALLFLLPVPGSSQYLDGRCGLLTNGKIANNISSPWMAYLH---TSELLYVCGGTVITE 64
            |..:.::....||...||:.:|:..|     ||.:....:||:..:.   :|.:  .|.||:|.|
  Fly     2 SATLRLAVFALLLFYQGSALFLEQNC-----GKSSVFSPAPWLVKIRPELSSNI--TCTGTLINE 59

  Fly    65 KLVLTAAHCTRASEQLVARIGEFIGT-DDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLAT 128
            :.|||||.|.....:|:.|:||..|| .:::.....|..|::..||..|::.:...:||:|.|.|
  Fly    60 RFVLTAASCIDYQTELIVRLGEIDGTLQNSSKLQYEEIYVARALIHRSYSSESHQYNIALLRLKT 124

  Fly   129 DIVFSKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGT 193
            .:|:.|.|:||||        .::..:|.....:.:...:||........|.::..|...:|.|.
  Fly   125 SVVYKKNIQPICI--------DVNVGKVPKAPTFEIEKKKNEEPKKNKAGIMKRFLNWFLSLFGV 181

  Fly   194 ------AILSSQFCAGDSDSKLCNVDFSSPLGAIITFKNIQRYVLI---GIATTNQKCKRASVYT 249
                  .||..|..|               :|..:| |.|....|.   ||.:......:..|||
  Fly   182 REPRPDVILPPQPIA---------------VGWPLT-KQINESALFHQYGILSHRNSESKKDVYT 230

  Fly   250 DVLSHTDFI 258
            ||:::.::|
  Fly   231 DVMAYVNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 62/237 (26%)
Tryp_SPc 33..258 CDD:304450 62/237 (26%)
CG43125NP_001247344.1 Tryp_SPc 37..>137 CDD:304450 35/101 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463437
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.