DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4650 and CG42694

DIOPT Version :9

Sequence 1:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster
Sequence 2:NP_001188994.1 Gene:CG42694 / 10178792 FlyBaseID:FBgn0261584 Length:512 Species:Drosophila melanogaster


Alignment Length:268 Identity:70/268 - (26%)
Similarity:117/268 - (43%) Gaps:25/268 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ALLFLLPVPGS---SQYLDGRCGLLTNGKIANNISSP---WMAYLHTSELLYV-CGGTVITEKLV 67
            |.|.:|.|..|   |::||..||...:.:....:..|   |:|  |.|...:| |.|::|:::.|
  Fly     6 AWLLMLTVLQSHVNSKFLDDYCGAPISNQSITKLRQPQAGWLA--HISNGTHVLCSGSLISKQFV 68

  Fly    68 LTAAHCTRASEQLVARIGEFIGTDDANDTMLSEYQVSQTFIHSLYNTTTSANDIAILGLATDIVF 132
            |:||.|.....:|..::|....|...:     .|.||...|.| ::......||.:|.|:..:.:
  Fly    69 LSAAQCIDVHGKLFVQLGVSNATKSPH-----WYTVSNVVIPS-HSGKRLQRDIGLLKLSQSVDY 127

  Fly   133 SKTIRPICIVWWTIWRKYIDNIQVLSGAQWGLPNDRNESDAFRITDIRRQPANMCSTLNGTAILS 197
            :..:.||||...|.....:..:|..:.:.| |..::| .....::.:.|....:  .|:|. :..
  Fly   128 NDFVYPICIALNTNTLDMVKILQNFTTSAW-LSKNKN-PQTIVLSQLSRDRCKL--NLSGN-VTP 187

  Fly   198 SQFCAGD-SDSKLCNVDFSSPL-GAIITFKNIQRYVLIGI---ATTNQKCKRASVYTDVLSHTDF 257
            .:.||.. ..:..|.:|..|.| ..||...||.|.:|.||   ......|...::|.||.....:
  Fly   188 KEICAASLQRNNSCFIDSGSALTQPIIQGSNIVREMLFGIRGYVNGRSWCSEPAIYIDVAECVGW 252

  Fly   258 ILSVWRQY 265
            |.:|.:||
  Fly   253 IETVVQQY 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 56/233 (24%)
Tryp_SPc 33..258 CDD:304450 56/233 (24%)
CG42694NP_001188994.1 Tryp_SPc 46..256 CDD:304450 56/222 (25%)
Tryp_SPc 46..253 CDD:214473 55/219 (25%)
Tryp_SPc 319..505 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000404
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108863
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.