DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and RPN7

DIOPT Version :9

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_015433.1 Gene:RPN7 / 856223 SGDID:S000006312 Length:429 Species:Saccharomyces cerevisiae


Alignment Length:340 Identity:59/340 - (17%)
Similarity:124/340 - (36%) Gaps:72/340 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VCPELSVLALELALNHVKTTYN----VKLYDELYKTLCVEVDRKYPNQSKGNEELHTTGGSEPST 93
            :|.|..|...:..|.|.:.:.:    :|...|||..||.:      |:||               
Yeast    66 LCEEYLVNNGQSDLEHDEKSDSLNEWIKFDQELYNELCKK------NESK--------------- 109

  Fly    94 SSGRGRVVVPYDSYWVEDNIMEATLMLQELDAELNFKKSNSGSSYVRRILEEIGDHHEKSGNLQM 158
                               |.|....:|:|:      :.:.|.....:....:|:::.:.|:...
Yeast   110 -------------------IKELNEKIQKLE------EDDEGELEQAQAWINLGEYYAQIGDKDN 149

  Fly   159 AVKFYARARPYCTSSENVINMFRNLIRVSIYMENWWHVLTYIDEAKQYAYGFENLAQ-----EVP 218
            |.|...::.....|:...|::...:.|:..:..:..:|       |:......::.:     |..
Yeast   150 AEKTLGKSLSKAISTGAKIDVMLTIARLGFFYNDQLYV-------KEKLEAVNSMIEKGGDWERR 207

  Fly   219 ARLSCVAGLAHLGLKIYKSAAQYFLSTPYGRYDYDKIVAPEDVTLYAGLCALATFDRETLQLNAI 283
            .|.....|:..|.::.:|.||:..:.: ...:...::.:.|.:..||.:..|.|.:|..|:...|
Yeast   208 NRYKTYYGIHCLAVRNFKEAAKLLVDS-LATFTSIELTSYESIATYASVTGLFTLERTDLKSKVI 271

  Fly   284 NSEAFKPFFQLSPKMWTILA---KFYAGEFDACMTLLREIENHVRLDV-YLSPHVSALYDLIMAR 344
            :|.........:..:.:|.:   ..||.::.:....|.|...:|.:.. ||:.|.    |..:..
Yeast   272 DSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLIPCKYLNRHA----DFFVRE 332

  Fly   345 MLKKRNREVMTESVK 359
            |.:|...::: ||.|
Yeast   333 MRRKVYAQLL-ESYK 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 28/180 (16%)
RPN7NP_015433.1 RPN7 2..429 CDD:227514 59/340 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.