DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and PCI8

DIOPT Version :9

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_085069.3 Gene:PCI8 / 854739 SGDID:S000001333 Length:444 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:49/200 - (24%)
Similarity:70/200 - (35%) Gaps:68/200 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MLHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVKTTYN--VKLYDELYKTLCVEVD 70
            ::.:|  .|.|.|...|..||...|:.| |.|..|||.:|   |.:|  .|::......:|:   
Yeast   233 LISIP--LDNYDDFIYLSDLKQFFQMTP-LLVNCLELLIN---TNFNKFFKIWHGEINKICM--- 288

  Fly    71 RKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPYDSYW---------------------VEDNIM 114
                      |.|..    |||.||. ..|::....|:                     :||...
Yeast   289 ----------ESLFL----EPSWSSS-AAVIMRCKIYFFYLRISKKLQFSYLSSTLGIDLEDIKE 338

  Fly   115 EATLMLQELDAELNFKKSNSGSSYVRRILEEIGD--HHEKSGNLQMAVKFYARARPYCTSSENVI 177
            |.|.::  :..:|||              |..||  |.|.|..||..|...:|..   |....||
Yeast   339 ELTKLI--ISGQLNF--------------EIDGDVIHFEDSSILQSIVNEISRNG---TMINEVI 384

  Fly   178 NMFRN 182
            :..:|
Yeast   385 DKLKN 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 21/100 (21%)
PCI8NP_085069.3 PINT 296..387 CDD:214509 25/110 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346564
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.