DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and FUS6

DIOPT Version :9

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_567109.1 Gene:FUS6 / 825286 AraportID:AT3G61140 Length:441 Species:Arabidopsis thaliana


Alignment Length:359 Identity:112/359 - (31%)
Similarity:176/359 - (49%) Gaps:46/359 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 DNGEETM----------LHLPSYADRYTDIPRLIRLKFIAQVC---PELSVLALELALNHVKTTY 53
            :.||||.          |.:.:||..|....:::||.|||..|   ..|...||.:|.:.:|...
plant    17 NGGEETSNRRPIISGEPLDIEAYAALYKGRTKIMRLLFIANHCGGNHALQFDALRMAYDEIKKGE 81

  Fly    54 NVKLYDELYKTLCVEVDRKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPYDSYWVEDNIMEATL 118
            |.:|:.|:...:...:..||                             ..|..|.|.....|..
plant    82 NTQLFREVVNKIGNRLGEKY-----------------------------GMDLAWCEAVDRRAEQ 117

  Fly   119 MLQELDAELNFKKSNSGSSYVRRILEEIGDHHEKSGNLQMAVKFYARARPYCTSSENVINMFRNL 183
            ...:|:.||:..::|.....:|....:.||.:...|.|..|.|.|.|.|.|||:::::|:|..|.
plant   118 KKVKLENELSSYRTNLIKESIRMGYNDFGDFYYACGMLGDAFKNYIRTRDYCTTTKHIIHMCMNA 182

  Fly   184 IRVSIYMENWWHVLTYIDEAKQYAYGFENLAQEVPARLSCVAGLAHLGLKIYKSAAQYFLS-TPY 247
            |.|||.|..:.||.:|:::|:|..   |.|...|.|:|.|.:|||||.||.||.||:.||. .|.
plant   183 ILVSIEMGQFTHVTSYVNKAEQNP---ETLEPMVNAKLRCASGLAHLELKKYKLAARKFLDVNPE 244

  Fly   248 GRYDYDKIVAPEDVTLYAGLCALATFDRETLQLNAINSEAFKPFFQLSPKMWTILAKFYAGEFDA 312
            ....|::::||:|:..|.||||||:|||..|:...|::..|:.|.:|.|.:..::..||:..:.:
plant   245 LGNSYNEVIAPQDIATYGGLCALASFDRSELKQKVIDNINFRNFLELVPDVRELINDFYSSRYAS 309

  Fly   313 CMTLLREIENHVRLDVYLSPHVSALYDLIMARML 346
            |:..|..:::::.||::|..||..|||.|..:.|
plant   310 CLEYLASLKSNLLLDIHLHDHVDTLYDQIRKKAL 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 69/176 (39%)
FUS6NP_567109.1 RPN7 104..278 CDD:402301 69/176 (39%)
PCI 293..397 CDD:396121 15/51 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0686
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D859626at2759
OrthoFinder 1 1.000 - - FOG0005242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14145
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.