DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and gps1

DIOPT Version :9

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:XP_021327265.1 Gene:gps1 / 777711 ZFINID:ZDB-GENE-041111-240 Length:527 Species:Danio rerio


Alignment Length:348 Identity:138/348 - (39%)
Similarity:211/348 - (60%) Gaps:21/348 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 EETMLHLPSYADRYTDIPRLIRLKFIAQVCPELSVLALELALNHVKTTYNVKLYDELYKTLCVEV 69
            |...|.|..||..|:.:.|:.||:|||..||:|.|.||::||:.|:.|:||.:|:|:::.| .|.
Zfish    78 ENPTLDLEQYASSYSGLMRIERLQFIADHCPQLRVEALKMALSFVQRTFNVDVYEEIHRKL-TEA 141

  Fly    70 DRKYPNQSKGNEELHTTGGSEPSTSSGRGRVVVPYDSYWVEDNIMEATLMLQELDAELNFKKSNS 134
            .|    :.:|..:....|..||.          |.|:.|.|....:|.|.|::||.:|...|.||
Zfish   142 TR----EVQGVPDAVPEGAVEPP----------PLDTAWAESTRKKALLKLEKLDTDLKNYKGNS 192

  Fly   135 GSSYVRRILEEIGDHHEKSGNLQMAVKFYARARPYCTSSENVINMFRNLIRVSIYMENWWHVLTY 199
            ....:||..:::|||:...|:|..|:|.|:|||.||||:::||||..|:|:||:|::||.|||:|
Zfish   193 IKESIRRGHDDLGDHYLDCGDLSNALKCYSRARDYCTSAKHVINMCLNVIKVSVYLQNWSHVLSY 257

  Fly   200 IDEAKQYAYGFENLA------QEVPARLSCVAGLAHLGLKIYKSAAQYFLSTPYGRYDYDKIVAP 258
            :.:|:......|...      |.|..:|.|.||||.|..:.||.||:.||...:...|:.::::|
Zfish   258 VSKAESTPEIAEQRGERDSQNQAVLTKLKCAAGLAELASRKYKPAAKCFLQASFDHCDFPELLSP 322

  Fly   259 EDVTLYAGLCALATFDRETLQLNAINSEAFKPFFQLSPKMWTILAKFYAGEFDACMTLLREIENH 323
            .:|.:|.||||||||||:.||.|.|:|.:||.|.:|.|::..|:.|||..::.:|:.:|.|::::
Zfish   323 SNVAVYGGLCALATFDRQELQRNVISSSSFKLFLELEPQVRDIIFKFYESKYASCLKMLDEMKDN 387

  Fly   324 VRLDVYLSPHVSALYDLIMARML 346
            :.||:||:|||..||..|..|.|
Zfish   388 LLLDMYLAPHVRTLYTQIRNRAL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 77/181 (43%)
gps1XP_021327265.1 RPN7 163..345 CDD:313757 77/181 (43%)
PCI 360..464 CDD:307522 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D223526at33208
OrthoFinder 1 1.000 - - FOG0005242
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.