DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CSN1a and Rpn7

DIOPT Version :9

Sequence 1:NP_609720.1 Gene:CSN1a / 34857 FlyBaseID:FBgn0028838 Length:364 Species:Drosophila melanogaster
Sequence 2:NP_651048.1 Gene:Rpn7 / 42641 FlyBaseID:FBgn0028688 Length:389 Species:Drosophila melanogaster


Alignment Length:321 Identity:73/321 - (22%)
Similarity:120/321 - (37%) Gaps:59/321 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LIRLKFIAQVCPELSVLALELALNHVKTTYNVKLYDELYKTLCVE----VDRKYPNQSKGNEELH 84
            |.:.||:..:.......||:..|.....|.|:..:   |:.:|.|    ||:....:.|.|    
  Fly    19 LAQTKFLLTLAEYKQDAALKAKLLEAIRTENMAPW---YEHICSELGWTVDKDLLARMKEN---- 76

  Fly    85 TTGGSEPSTSSGRGRVVVPYDSYWVEDNIMEATLMLQELDA-ELNFKKSNSGSSYVRRILEEIGD 148
                         .||.|......:||    |...|.|::. |.|.||    |.|:.||      
  Fly    77 -------------NRVEVEQLDAAIED----AEKNLGEMEVREANLKK----SEYLCRI------ 114

  Fly   149 HHEKSGNLQMAVKFYARARPYCTSSENVINMFRNLIRVSIYMENWWHVLTYIDEAKQYAYGFENL 213
                 |:...|...:.:......|..:.:::..:|||:.::..:...:...||:||   |..|..
  Fly   115 -----GDKAAAETAFRKTYEKTVSLGHRLDIVFHLIRLGLFYLDHDLITRNIDKAK---YLIEEG 171

  Fly   214 AQ-EVPARLSCVAGLAHLGLKIYKSAAQYFLS-----TPYGRYDYDKIVAPEDVTLYAGLCALAT 272
            .. :...||....|:..:.::.:|:||.:||.     |.|...||...|.   .|:|..:.||  
  Fly   172 GDWDRRNRLKVYQGVYSVAVRDFKAAATFFLDTVSTFTSYELMDYPTFVR---YTVYVAMIAL-- 231

  Fly   273 FDRETLQLNAINSEAFKPFFQLSPKMWTILAKFYAGEFDACMTLLREIENHVRLDVYLSPH 333
             .|..|:...|.....:......|.:...|...|..:::.....|..:|..:|||..:.||
  Fly   232 -PRNELRDKVIKGSEIQEVLHGLPDVKQFLFSLYNCQYENFYVHLAGVEKQLRLDYLIHPH 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CSN1aNP_609720.1 RPN7 105..281 CDD:287560 44/182 (24%)
Rpn7NP_651048.1 RPN7 15..382 CDD:227514 73/321 (23%)
RPN7 66..239 CDD:287560 50/217 (23%)
PCI 254..358 CDD:279707 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471353
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR14145
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.