DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4691 and CG8701

DIOPT Version :9

Sequence 1:NP_609719.1 Gene:CG4691 / 34856 FlyBaseID:FBgn0028870 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610376.1 Gene:CG8701 / 35812 FlyBaseID:FBgn0033287 Length:246 Species:Drosophila melanogaster


Alignment Length:214 Identity:72/214 - (33%)
Similarity:90/214 - (42%) Gaps:44/214 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 PRKDLKPLEKKDRSKVYDACWQTTRRTEYKCRSDPEFQMHAFIDSRKSCLEDPCATEMLAIDLTH 117
            ||...||..||:..                      ||.|..:.....|..||||......|..:
  Fly    55 PRFAKKPPPKKEDG----------------------FQFHHLVKQPPECCTDPCAERFPPYDQCY 97

  Fly   118 YKPSDMGKRKYPRTWFEC-VVKRRKRKAHC--VPVPPPMPRRKRKS--KKPRCPEDLCVLGKLEL 177
            ||.||...|||..||.|| .:|.:.:|..|  ..:.||:||||||.  ....||.::        
  Fly    98 YKISDKATRKYQVTWVECPPIKIKPKKICCYEAGIRPPIPRRKRKKFVTSAECPTNV-------- 154

  Fly   178 NLIKPCVKESSKCPRFRMPNCCVAARDPPKCRRPFRR--CGQRPKTKYPSFSECRRDPFPDPRPI 240
                .|..|...|||.:||.|  .|.|...|....|:  | .:.|..|||||||.|.....||.:
  Fly   155 ----ECPTEGGPCPRIKMPGC--KAVDSVSCHVVRRKTDC-VKVKAPYPSFSECSRSRLRKPRGV 212

  Fly   241 ECNCLLKPAICDMWRHYRR 259
            |||||..|:.||:.|..::
  Fly   213 ECNCLDVPSSCDLIRELKK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4691NP_609719.1 DM6 100..258 CDD:214775 63/164 (38%)
CG8701NP_610376.1 DUF1431 81..231 CDD:284625 63/164 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451857
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.