DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4691 and boly

DIOPT Version :9

Sequence 1:NP_609719.1 Gene:CG4691 / 34856 FlyBaseID:FBgn0028870 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610373.2 Gene:boly / 35809 FlyBaseID:FBgn0050362 Length:255 Species:Drosophila melanogaster


Alignment Length:231 Identity:106/231 - (45%)
Similarity:130/231 - (56%) Gaps:21/231 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DGWESGYPAPLLPRKDLKPLEKKDRSK--VYDACWQTTRRTEYKCRSDPEFQMHAFIDSRKSCLE 103
            |.:|.|.|.....|||||..:..|.:|  |.|.||.:.||:||||||||||.:.|||||||.||.
  Fly    33 DPYEFGAPTMATERKDLKKNDPADNTKVPVKDICWMSMRRSEYKCRSDPEFNVPAFIDSRKRCLS 97

  Fly   104 DPCATEMLAIDLTHYKPSDMGKRKYPRTWFECVVKRRKRKAHCVPVPPPMPRRKRKSKKPRCPED 168
            |.||......||..|||:|...|||.|||.||.::.|||||.|...||.:.||..:: .|..|..
  Fly    98 DRCAMAYPPSDLMFYKPTDKLNRKYQRTWCECELQERKRKAVCRSRPPKIHRRSLRT-LPLHPSK 161

  Fly   169 LCVLG--KLELNLIKPCVKESSKCPRFRMPNC-------CVAARDPPKCRRPFRRCGQRPKTKYP 224
            :|..|  .|.|.|.:|...:|| ||||:||.|       |...|.|..|        .||:||||
  Fly   162 VCSKGNKSLGLGLCRPKPAKSS-CPRFKMPFCKQAITTGCRPGRPPSNC--------VRPRTKYP 217

  Fly   225 SFSECRRDPFPDPRPIECNCLLKPAICDMWRHYRRR 260
            |||||:..|.||..|..|.|:.:|.:|.:|.:||.:
  Fly   218 SFSECQPYPLPDVPPTHCFCINQPPMCVVWNYYRMK 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4691NP_609719.1 DM6 100..258 CDD:214775 70/166 (42%)
bolyNP_610373.2 DM6 94..251 CDD:214775 70/166 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45451819
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F9I4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20977
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.