DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42685 and brv3

DIOPT Version :9

Sequence 1:NP_609717.5 Gene:CG42685 / 34854 FlyBaseID:FBgn0261571 Length:1609 Species:Drosophila melanogaster
Sequence 2:NP_001284831.1 Gene:brv3 / 31246 FlyBaseID:FBgn0040333 Length:750 Species:Drosophila melanogaster


Alignment Length:555 Identity:92/555 - (16%)
Similarity:178/555 - (32%) Gaps:217/555 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly  1041 NFHNIYWWYPDPFPSKTSVLIVHAYSPVQFFRSAKEFQLTNPLVYKTNITHFNDASFNQY----- 1100
            ::.:.||...:|            :.|::.     .|:..:.|:  .|..|.  .|.|.|     
  Fly   253 HYSDKYWRIYEP------------WIPIKM-----GFEFLDALL--MNFDHV--GSLNSYPELAG 296

  Fly  1101 ---MTNNSIQNSTEVHIYSVMLNHKAMLAVRIVNCSELMY---------IKMRLHRWPTLGQIRQ 1153
               :...|..||.:|..| :..||...|....|.....:|         ..:|:.:.|..|    
  Fly   297 YVSLLARSAANSMKVIDY-LSENHWLTLNTSAVFIDFTLYNVDVNLFSICTLRVEKTPFGG---- 356

  Fly  1154 HACRITPDMQGKRIWIANSCERSP--------AYVAI-------------HKPGEIR--YKTED- 1194
                |.||:|.....:..:.::.|        .||.:             ::|..::  :...| 
  Fly   357 ----IVPDVQVDSAKLLENVDQMPYTGLLALLIYVLVFIQFAQTLAVKLWYEPHLLKSVWNKLDL 417

  Fly  1195 ---------------KDQLSARGRKKGNRTHDGSETPEVRQKADFIDYDNEDIVEEVLPLNYSIL 1244
                           ::.|.|...||          .|...|.:|||:.....:.::..:....|
  Fly   418 FIFMVNVLVVVLVVLRESLVASMMKK----------VEGASKMEFIDFRRPSRMHQLTTITIGFL 472

  Fly  1245 LEIYQCNIWK-----------NRSLDPGWS-----------------------EDHCTTSFEHSR 1275
            :.|....:|:           .|:|...||                       ..:.:::|....
  Fly   473 ICITTLRLWRVLQFASVFKLFTRTLYLAWSAVASTAIAIVIFLIGFCFAVVTINGNYSSNFNKLV 537

  Fly  1276 GSSVQCTCHTLGALSSRIFPISSQLFVEHIPVPIFTFNMILMIFFALLFLLLVFKFLLHLNIISA 1340
            .|.|.|.|::.| .|:::.|  |:||.....:.|..:.:       |.|:::|....:.:::|:.
  Fly   538 KSMVMCMCYSFG-FSAQVKP--SELFHGGKWLGILCYGV-------LAFVIIVLLINVFVSLIND 592

  Fly  1341 YLKNPEFRLQCDASVGKS-----DQSFVSGSEILLVIVTGGQEFAG------------------- 1381
            |.           :|.|:     .::.::..|.|:|      ||:|                   
  Fly   593 YF-----------TVAKTIRDSERENRITFFEFLVV------EFSGVLGRFRKLPCWRRNYVRNG 640

  Fly  1382 --TTSNVKFYLKSPHRQQTSYQITQDPGHPKLLRNSTIKIMVPRGHIYIPTRLALRLVP------ 1438
              ...||...|.|..||             :|:|.   ::...|.|:..|......|:.      
  Fly   641 RTVAENVSRKLDSMDRQ-------------RLMRR---RLRQGRHHVSRPVSAEDALLEYKDRGD 689

  Fly  1439 ---NGRYPSWYCRSITVVDLKLKVQQLFLVESWIE 1470
               |..|         :::::|.:.::||.:.::|
  Fly   690 KMVNVHY---------ILNIQLTLIRMFLFDEYVE 715

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42685NP_609717.5 REJ 411..753 CDD:307914
PLAT 1367..1480 CDD:238061 24/134 (18%)
brv3NP_001284831.1 PKD_channel 170..595 CDD:285288 66/402 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1276906at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.