DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and ARHGAP25

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:XP_016860912.1 Gene:ARHGAP25 / 9938 HGNCID:28951 Length:650 Species:Homo sapiens


Alignment Length:704 Identity:155/704 - (22%)
Similarity:265/704 - (37%) Gaps:172/704 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 KKGWLMKQDNRTCEWSKHWFTLSGAALFYYRDPLCEERGVLDGVLDVNSLT--SVIPEPAASKQH 571
            |.|||.||.:....|.:.:|.|....|:||:|   ||.....|.:.:...|  .:...|..:.:.
Human    53 KMGWLKKQRSIVKNWQQRYFVLRAQQLYYYKD---EEDTKPQGCMYLPGCTIKEIATNPEEAGKF 114

  Fly   572 AFQL--TTWDKQRL-----VLASLSPSSRNSWLAVLRSAAGLP-------QLDTPPKQTDIEQDF 622
            .|::  .:||:.|:     ||.:.|.:....|:..||..||.|       :||   :....||.|
Human   115 VFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPCGAVFGQRLD---ETVAYEQKF 176

  Fly   623 IKAQLQQPSSSPVTPGTPAGPHFSSDEEYRTAS---EGGRRDSLDWGSPLSPSPPVLRSCLRNRS 684
                               |||.......:.|.   |.||.:.   |....|....|...||:..
Human   177 -------------------GPHLVPILVEKCAEFILEHGRNEE---GIFRLPGQDNLVKQLRDAF 219

  Fly   685 LASLHKRSRSSPPSSRRSTVDSVAS------DELPLLVVPEEM--------QPTESRELKQQCET 735
            .|.      ..|...|.:.|.:|||      .:||..|||...        |.|.:.|.|.|.|.
Human   220 DAG------ERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQEL 278

  Fly   736 LRAEASLREARMSELLATLQRTEQQLTARLQEQQQQLNSELTQAKQSASDLMHNLGMQLTESQCQ 800
            ::..:.|.....| ||:.:.|...::         |||..:.  |.|..:|...:|:.|..|:.:
Human   279 MKQLSILPRDNYS-LLSYICRFLHEI---------QLNCAVN--KMSVDNLATVIGVNLIRSKVE 331

  Fly   801 --------IKQLEDRLAQGIEENEGLYKRLRELQ---------------AQDHSGGAALSNLQRH 842
                    ..|::..:...|.::|.|:.:.:::.               |:...|..|..:|   
Human   332 DPAVIMRGTPQIQRVMTMMIRDHEVLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDL--- 393

  Fly   843 KIKRMDSLSDLTTISDIDPYCLQRDSLAEEYNELRSRFEKAVN-EIRAMKRELKQSQNQYDALEL 906
            :|.|.||.|.:|:.||......|:.|.|...:..:...||..: ::::.||.......:......
Human   394 RISRTDSFSSMTSDSDTTSPTGQQPSDAFPEDSSKVPREKPGDWKMQSRKRTQTLPNRKCFLTSA 458

  Fly   907 AQAALQQKLERRQHEDGAQLQLMAARIQDLTLKYSSSERQVRALKQKLAKSERRRSLSLKGKEQL 971
            .|.|...|:|..::|..:                .|||.:        |....||::|    :.|
Human   459 FQGANSSKMEIFKNEFWS----------------PSSEAK--------AGEGHRRTMS----QDL 495

  Fly   972 ELKLSELQR----ETVERKEGTPPESSSSESSSQSPLNAHLLQRLHSLEHVLLGSKERLEQSLTQ 1032
            . :||:.||    :.|....|:|.|.:|:.||.........|...:|  ....|.|...|:.:..
Human   496 R-QLSDSQRTSTYDNVPSLPGSPGEEASALSSQACDSKGDTLASPNS--ETGPGKKNSGEEEIDS 557

  Fly  1033 LQQIRAGQRTRRSVSPMNDR-KDGLRQLERALAET---CVMVSEQMELTCLQDSCHKCCDLRQRV 1093
            ||  |..|..|:.:...... ::.::.||:...:.   .|.::|::|                :.
Human   558 LQ--RMVQELRKEIETQKQMYEEQIKNLEKENYDVWAKVVRLNEELE----------------KE 604

  Fly  1094 EKLSALQQQTETDLQRSEQLLEQRETDLAQALEKCASQEQEQELLLQQRQELSE 1147
            :|.||..:.:..:::||.:.:|:|.    :|||     |:.:|.:...::..:|
Human   605 KKKSAALEISLRNMERSREDVEKRN----KALE-----EEVKEFVKSMKEPKTE 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 33/119 (28%)
PH 509..603 CDD:278594 28/102 (27%)
SbcC 726..1353 CDD:223496 93/454 (20%)
ARHGAP25XP_016860912.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.