DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and CYTH2

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:XP_006723535.1 Gene:CYTH2 / 9266 HGNCID:9502 Length:421 Species:Homo sapiens


Alignment Length:360 Identity:72/360 - (20%)
Similarity:135/360 - (37%) Gaps:53/360 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 TSSQSAGNLLSSLDLGPSSTKTAGSPLTTTQSALAD-----DEEDDGVETGEDVDEDEEDETSVP 296
            :.:|....|....||.|.......:.....|..|.:     :|..:.:...|.::.:|..:|.  
Human    19 SENQGLSPLPKPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTL-- 81

  Fly   297 RKSKTVSMGGQDEN-NRNAGNE--ITNRVSQPTTCLLIEDIRRDEKTIKDIANTITNLSQQQNKR 358
            ::::.::||.:..| :...|.:  :.|.:.|.|.    |:|.|.....:.:..|.......:.:.
Human    82 QRNRKMAMGRKKFNMDPKKGIQFLVENELLQNTP----EEIARFLYKGEGLNKTAIGDYLGEREE 142

  Fly   359 WSTAVNNALNNQHHFGHHSQYQVTSRDETDFQMSSNSSSTKSQNPASERPKSL--PLASNSTPAI 421
            .:.||.:|..:.|.|...:..|...:....|::...:........|..:...|  |....||.  
Human   143 LNLAVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTD-- 205

  Fly   422 VSAIVKKIPTVMEQGDKTKPTARLQLHLKSPKHYQHERGDPDGGCNLDELCVNYMAKTDELRSVG 486
             :..|.....:|.......|..|.:..|:  :.....||..:||...:||..|..   |.:|:  
Human   206 -TCYVLSFAVIMLNTSLHNPNVRDKPGLE--RFVAMNRGINEGGDLPEELLRNLY---DSIRN-- 262

  Fly   487 KANSKSSSGQGKP-PVKEESLN---------AKKGWLMKQDNRTCEWSKHWFTLSGAALFYYRDP 541
                       :| .:.|:..|         .::|||:|...|...|.:.||.|:...|:|:...
Human   263 -----------EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYT 316

  Fly   542 LCEE-RGVLDGVLDVNSLTSVIPEPAASKQHAFQL 575
            ..:| ||::.  |:..|:..| .:|  .|.:.|:|
Human   317 TDKEPRGIIP--LENLSIREV-DDP--RKPNCFEL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 21/68 (31%)
PH 509..603 CDD:278594 21/68 (31%)
SbcC 726..1353 CDD:223496
CYTH2XP_006723535.1 Sec7 83..265 CDD:396096 37/206 (18%)
PH_GRP1-like 280..399 CDD:269954 21/72 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.