DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and CYTH3

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:NP_004218.1 Gene:CYTH3 / 9265 HGNCID:9504 Length:399 Species:Homo sapiens


Alignment Length:432 Identity:80/432 - (18%)
Similarity:141/432 - (32%) Gaps:157/432 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 EEDDGVETG---EDVD-EDEEDETSVPRKSKTVSMGGQDENNRNAGNEITNRVSQPTTCLLIEDI 334
            :||.|.|.|   ||:. |:.|:...:.|:.|.                            ||:||
Human     2 DEDGGGEGGGVPEDLSLEEREELLDIRRRKKE----------------------------LIDDI 38

  Fly   335 RRDEKTIKDIANTITNLSQ-------QQNKRWS-------------------------------- 360
            .|.:..|.::...|.||:.       |:||:.:                                
Human    39 ERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQ 103

  Fly   361 ----------TAVNNALNNQ--------------HHFGHHSQYQVTSR-----------DETDFQ 390
                      |.:.:.|..:              |.|...:..|...:           .:.|..
Human   104 FLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRM 168

  Fly   391 MSSNSSSTKSQNPASERPKSLPLASNSTPAIVS-AIVKKIPTVMEQGDKTKPTARLQLHLKSPKH 454
            |.:.:|.....||.       ...|..|..::| ||:....::.....:.||||.        :.
Human   169 MEAFASRYCLCNPG-------VFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAE--------RF 218

  Fly   455 YQHERGDPDGGCNLDELCVN-YMAKTDELRSVGKANSKSSSGQGKPPVKEESLNAKKGWLMKQDN 518
            ....||..:||...:||..| |.:..:|...:.:.:....:.....|.:|       |||:|...
Human   219 IAMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDRE-------GWLLKLGG 276

  Fly   519 RTCEWSKHWFTLSGAALFYYRDPLCEE-RGVLDGVLDVNSLTSVIPEPAASKQHAFQL------- 575
            |...|.:.||.|:...|:|:.....:| ||::.  |:..|:..| .:|  .|.:.|:|       
Human   277 RVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIP--LENLSIREV-EDP--RKPNCFELYNPSHKG 336

  Fly   576 ------TTWDKQRLV--------LASLSPSSRNSWLAVLRSA 603
                  .|....|:|        :::.||..:..|:..::::
Human   337 QVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKAS 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 27/117 (23%)
PH 509..603 CDD:278594 27/115 (23%)
SbcC 726..1353 CDD:223496
CYTH3NP_004218.1 Sec7 66..248 CDD:396096 30/196 (15%)
PH_GRP1-like 263..382 CDD:269954 29/128 (23%)
C-terminal autoinhibitory region. /evidence=ECO:0000269|PubMed:23940353 391..399
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.