DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and ppp1r16a

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:NP_001072353.1 Gene:ppp1r16a / 779806 XenbaseID:XB-GENE-5762924 Length:549 Species:Xenopus tropicalis


Alignment Length:548 Identity:119/548 - (21%)
Similarity:183/548 - (33%) Gaps:113/548 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   951 KQKLAKSERRRSLSLKGKEQLELKLSELQRETVERKEGTPPESSSSESSSQSPLNAHLLQR---- 1011
            :::|..:::||:..||...|.|......:.:..::|:|     |..|.....|.|..||:.    
 Frog    20 QERLKHAQKRRAQQLKKWAQFEKDGQGKKAKGRQKKQG-----SKEERRVMFPQNVTLLEAAARN 79

  Fly  1012 -LHSLEHVLL-GSKERL--EQSLTQLQQIRAGQRTRRSVSPMNDRKDGLRQLERALAETCVMVSE 1072
             :..:.|:|. |....|  |..||.|.|           ..::|.::.:|.|..|.|:.....||
 Frog    80 DIEEVRHLLQNGFSPNLYNEDGLTALHQ-----------CCIDDYEEIVRMLIGAGADVNACDSE 133

  Fly  1073 -----QMELTCLQDSCHKCCDLRQRVEKLSALQQQTET--DLQRSEQLLEQRETDLA------QA 1124
                 ....||  ...|....|.:....|.|:......  ||...:..|:..||.:|      :.
 Frog   134 LWTPLHAAATC--GHLHLVELLIKHGANLLAVNSDGNMPYDLCEDDVTLDHIETAMAEQGITQEK 196

  Fly  1125 LEKCASQEQEQELLLQQRQELSEELGRQQERCRRLEKRLELLEREHGKQL-------------EC 1176
            :|:|....::.  :|:..|.|.|..|...            ....||..|             |.
 Frog   197 IEECRGATEQH--MLEDIQHLVETGGEVN------------AHNPHGTSLLHIAAANGYLATAEL 247

  Fly  1177 LREVYHTEHANAADEQSFRKRYQT----EIEQLRTLCEKGLSAMETSHKRLT-MD---------- 1226
            |.|  |....||.|:..:...:..    :|..:..|...|......|....| :|          
 Frog   248 LLE--HKAQVNARDQDGWEPLHAAACWGQIHVVELLVAHGADLNSKSQLDETPLDVCGDEEVRAK 310

  Fly  1227 -LEQKHKMEIERLLAEK-ETALAEETQATLAALDAMRKA--------HQSEVQREVARFKQEFLR 1281
             ||.|||.|..|...:| .|||...|.:..:....:|:.        ::.|.|:|...::|...|
 Frog   311 ILELKHKHEAIRKSQDKHRTALQRRTSSAGSRGKVVRRVSVTERTNMYRREHQKEAMVWQQRGSR 375

  Fly  1282 QVQRGEQMRGDGAKLKEEDLGELRMEILAFSEKYSIKCVENAALEEKLHMANSKLRHFQQMQQLE 1346
            : ...||...|..|....::.:.:....|..||.:....:....|......:|.|:.|.:...|.
 Frog   376 E-NEVEQQDEDEDKTTNTEMQQHQPSAEAEPEKAARNEGDEGPAEGSDVPVSSSLQSFHRNGSLV 439

  Fly  1347 LRNKQFRAHLASDDPSNDVHFVQGLTSDAREDADCEDSEPAPQILGATATRTTA-TTTTTATATT 1410
            ..:|    |..|......|.:......|...|...|.|.           .|.| .....|.|..
 Frog   440 PASK----HTFSKRLDRSVSYQLATQGDTGPDLSNERSH-----------HTLAELKRQRAAAKL 489

  Fly  1411 TSAAPSETESNPDSDRETADSSRAPPEK 1438
            ...||...   |.||.|..|||.:.||:
 Frog   490 QRHAPPPP---PLSDSEAQDSSGSAPEE 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094
PH 509..603 CDD:278594
SbcC 726..1353 CDD:223496 97/460 (21%)
ppp1r16aNP_001072353.1 ANK repeat 72..98 CDD:293786 6/25 (24%)
ANK 95..282 CDD:238125 43/215 (20%)
ANK repeat 100..131 CDD:293786 9/41 (22%)
ANK repeat 133..164 CDD:293786 7/32 (22%)
ANK 223..332 CDD:238125 25/122 (20%)
ANK repeat 228..259 CDD:293786 9/32 (28%)
ANK repeat 261..289 CDD:293786 3/27 (11%)
GREB1 <328..>530 CDD:318077 45/206 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4807
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.