DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment osp and PLEKHA2

DIOPT Version :9

Sequence 1:NP_001162975.1 Gene:osp / 34850 FlyBaseID:FBgn0003016 Length:1566 Species:Drosophila melanogaster
Sequence 2:NP_067636.1 Gene:PLEKHA2 / 59339 HGNCID:14336 Length:425 Species:Homo sapiens


Alignment Length:333 Identity:67/333 - (20%)
Similarity:118/333 - (35%) Gaps:99/333 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 QPTT--CLLIEDIRR-------DEKTIKDIANTITNLSQQQNKRWSTAVNNALNNQHHFGHHSQY 379
            :|.|  |.:|..:.:       |:|.:||               |..|:|.|            .
Human    75 KPKTPFCFVINALSQRYFLQANDQKDMKD---------------WVEALNQA------------S 112

  Fly   380 QVTSRDETDFQMSSNSSSTKSQNPASERPKSLPLASNSTPAIVSAIVKKIPTVMEQGD---KTKP 441
            ::|........|::....:.:..||.|:.   |..:..| .|:..:|...|.....||   .::|
Human   113 KITVPKGGGLPMTTEVLKSLAAPPALEKK---PQVAYKT-EIIGGVVVHTPISQNGGDGQEGSEP 173

  Fly   442 TARLQLHLKSPKHYQHERGDPDGGCNLDELCVNYMAKTDELRSVGKANSKSSSGQGKPPVKEESL 506
            .:...|. :|..:.      |..||                        ::|:|   ||:     
Human   174 GSHTILR-RSQSYI------PTSGC------------------------RASTG---PPL----- 199

  Fly   507 NAKKGWLMKQDNRTCEWSKHWFTLSGAALFYYRDPLCEE-----RGV-LDGVLDVNSLTSVIPEP 565
             .|.|:.:||.|....|.:.:|.|....:.|::   ||:     |.: |..||..:... |....
Human   200 -IKSGYCVKQGNVRKSWKRRFFALDDFTICYFK---CEQDREPLRTIFLKDVLKTHECL-VKSGD 259

  Fly   566 AASKQHAFQLTTWDKQRLVLASLSPSSRNSWLAVLRSAAGLPQLDTPPKQTDIEQDFIKAQLQQP 630
            ...:.:.|::.|..:...|.|. ||...:||:..:  .|.:..|...|::|...:..   .|.:|
Human   260 LLMRDNLFEIITSSRTFYVQAD-SPEDMHSWIKEI--GAAVQALKCHPRETSFSRSI---SLTRP 318

  Fly   631 SSSPVTPG 638
            .||.::.|
Human   319 GSSSLSSG 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ospNP_001162975.1 PH_RIP 48..191 CDD:269942
PH 85..185 CDD:278594
PH_M-RIP 509..613 CDD:270094 26/109 (24%)
PH 509..603 CDD:278594 24/99 (24%)
SbcC 726..1353 CDD:223496
PLEKHA2NP_067636.1 PH1_TAPP1_2 1..119 CDD:270089 13/70 (19%)
PH 10..113 CDD:278594 12/64 (19%)
PH2_TAPP1_2 192..307 CDD:270090 31/130 (24%)
PH 199..297 CDD:278594 25/110 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 312..332 5/18 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 352..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.